1. Recombinant Proteins
  2. CD Antigens
  3. B Cell CD Proteins
  4. Ig-alpha/CD79a
  5. CD79A Protein, Human (HEK293, His)

CD79A Protein, Human (HEK293, His)

Cat. No.: HY-P72709
Handling Instructions

The CD79A protein is critical for initiating the B cell antigen receptor complex (BCR) signaling cascade upon antigen binding. It promotes internalization, transport to late endosomes, and antigen presentation of BCR complexes. CD79A Protein, Human (HEK293, His) is the recombinant human-derived CD79A protein, expressed by HEK293 , with C-6*His labeled tag. The total length of CD79A Protein, Human (HEK293, His) is 111 a.a., with molecular weight of 25-40 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CD79A protein is critical for initiating the B cell antigen receptor complex (BCR) signaling cascade upon antigen binding. It promotes internalization, transport to late endosomes, and antigen presentation of BCR complexes. CD79A Protein, Human (HEK293, His) is the recombinant human-derived CD79A protein, expressed by HEK293 , with C-6*His labeled tag. The total length of CD79A Protein, Human (HEK293, His) is 111 a.a., with molecular weight of 25-40 kDa.

Background

The CD79A protein is essential for the initiation of the signal transduction cascade in response to antigen binding to the B-cell antigen receptor complex (BCR). It plays a crucial role in internalizing the BCR complex, trafficking it to late endosomes, and facilitating antigen presentation. CD79A is also necessary for the surface expression of the BCR and efficient differentiation of pro- and pre-B-cells. It promotes the autophosphorylation and activation of SYK, a key signaling molecule, by binding to BLNK and bringing it into proximity with SYK, allowing for the phosphorylation of BLNK. CD79A also interacts with certain Src-family tyrosine kinases, such as FYN and LYN, increasing their activity. Notably, it represses BCR signaling during the development of immature B-cells. CD79A forms a disulfide-linked heterodimer with CD79B, and together they constitute the B-cell antigen receptor complex, where the alpha/beta chain heterodimer is non-covalently associated with an antigen-specific membrane-bound surface immunoglobulin composed of two heavy chains and two light chains. CD79A interacts with SYK through its phosphorylated ITAM domain, facilitating SYK autophosphorylation and activation. Additionally, when phosphorylated on Tyr-210, CD79A interacts with the SH2 domain of BLNK/SLP65, bringing BLNK into proximity with SYK and allowing SYK to phosphorylate BLNK, which is necessary for the trafficking of the BCR to late endosomes.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P11912 (L33-R143)

Gene ID

973  [NCBI]

Molecular Construction
N-term
CD79A (L33-R143)
Accession # P11912
6*His
C-term
Synonyms
B-cell antigen receptor complex-associated protein alpha chain; CD79a; IGA; MB1
AA Sequence

LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNR

Molecular Weight

25-40 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CD79A Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD79A Protein, Human (HEK293, His)
Cat. No.:
HY-P72709
Quantity:
MCE Japan Authorized Agent: