1. Recombinant Proteins
  2. Others
  3. MFG-E8 Protein, Mouse (HEK293, His)

The MFG-E8 protein plays a critical role in promoting the phagocytic clearance of apoptotic cells in various tissues.As a specific ligand, it interacts with alpha-v/beta-3 and alpha-v/beta-5 receptors and also binds independently to phosphatidylserine-rich cell surfaces.MFG-E8 Protein, Mouse (HEK293, His) is the recombinant mouse-derived MFG-E8 protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The MFG-E8 protein plays a critical role in promoting the phagocytic clearance of apoptotic cells in various tissues.As a specific ligand, it interacts with alpha-v/beta-3 and alpha-v/beta-5 receptors and also binds independently to phosphatidylserine-rich cell surfaces.MFG-E8 Protein, Mouse (HEK293, His) is the recombinant mouse-derived MFG-E8 protein, expressed by HEK293 , with N-His labeled tag.

Background

MFG-E8 (Milk Fat Globule-Epidermal Growth Factor 8) is a versatile protein that contributes significantly to the phagocytic removal of apoptotic cells in various tissues. Serving as a specific ligand for the alpha-v/beta-3 and alpha-v/beta-5 receptors, MFG-E8 facilitates the recognition and clearance of apoptotic cells by phagocytes. Additionally, it exhibits binding capabilities to phosphatidylserine-enriched cell surfaces independently of receptors. With its role as a zona pellucida-binding protein, MFG-E8 may contribute to gamete interactions (By similarity). Notably, MFG-E8 is crucial for maintaining intestinal epithelial homeostasis and promoting mucosal healing, highlighting its significance in gastrointestinal health. Furthermore, MFG-E8 plays a key role in promoting VEGF-dependent neovascularization, emphasizing its involvement in angiogenesis and tissue repair processes.

Biological Activity

Measured by the ability of the immobilized protein to support the adhesion of SVEC4-10 mouse vascular endothelial cells. The ED50 for this effect is 35.78 ng/mL, corresponding to a specific activity is 2.795×104 units/mg.

  • Measured by the ability of the immobilized protein to support the adhesion of SVEC4-10 mouse vascular endothelial cells. The ED50 for this effect is 35.78 ng/mL, corresponding to a specific activity is 2.795×104 units/mg.
Species

Mouse

Source

HEK293

Tag

N-His

Accession

P21956 (A23-C463)

Gene ID
Molecular Construction
N-term
His
MFG-E8 (A23-C463)
Accession # P21956
C-term
Synonyms
Lactadherin; MFGM; MFG-E8; SED1; MP47; BA46; EDIL1; HsT19888; Medin; MFG1; OAcGD3S; SPAG10
AA Sequence

ASGDFCDSSLCLNGGTCLTGQDNDIYCLCPEGFTGLVCNETERGPCSPNPCYNDAKCLVTLDTQRGDIFTEYICQCPVGYSGIHCETETNYYNLDGEYMFTTAVPNTAVPTPAPTPDLSNNLASRCSTQLGMEGGAIADSQISASSVYMGFMGLQRWGPELARLYRTGIVNAWTASNYDSKPWIQVNLLRKMRVSGVMTQGASRAGRAEYLKTFKVAYSLDGRKFEFIQDESGGDKEFLGNLDNNSLKVNMFNPTLEAQYIKLYPVSCHRGCTLRFELLGCELHGCSEPLGLKNNTIPDSQMSASSSYKTWNLRAFGWYPHLGRLDNQGKINAWTAQSNSAKEWLQVDLGTQRQVTGIITQGARDFGHIQYVASYKVAHSDDGVQWTVYEEQGSSKVFQGNLDNNSHKKNIFEKPFMARYVRVLPVSWHNRITLRLELLGC

Molecular Weight

Approximately 60-75 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

MFG-E8 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MFG-E8 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P77749
Quantity:
MCE Japan Authorized Agent: