CLEC14A Protein, Rat (HEK293, Fc)

CLEC14A Protein, Rat (HEK293, Fc) is the recombinant rat-derived CLEC14A protein, expressed by HEK293 , with C-hFc labeled tag. The total length of CLEC14A Protein, Rat (HEK293, Fc) is 398 a.a., with molecular weight of ~110 & 37 kDa, respectively.

Measured by its binding ability in a functional ELISA. Immobilized Rat CLEC14A at 1 µg/mL can bind Mouse VEGF R3. The ED₅₀ for this effect is 1.457 μg/mL.

Rat

HEK293

C-hFc

Q642B4 (M1-T398)

314148  [NCBI]

MRPALALCLLCPAFWPRPGNGEHPTADRAVCSVPGACYSLHHAAMKRRAAEEACSLRGGTLSTVQSGSELQAVLKLFRAGPGPGGGSKDLMFWVALERDRSQCTQEREPLRGFSWLYTDSEDSENRTLPWVEEPQLSCTVRKCAVLQATGGVEPAGWKEMRCQQRADGYLCKYQFEALCPAPRPGAASNLSFQAPFRLSSSALDFSPPGTEVSAMCPRDFSVSSICVQEETGARWDGLFPGSLLCPCSGRYLLAGKCVELADCLDYLGNFACECAVGFELGKDKRSCETKAEGQLTLEGTKLPTRNVSATPASPVTNKSWPGQVYDKPGEMPQVTGQDRIATSVPEILQWGTQSTLPTVQTSPQTKPKVTITPSGSMMPTLNFASSPPVSLTFDSSST

Approximately 90-120 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.