IL-5 Protein, Mouse (HEK293, His)

IL-5 protein is expressed by T lymphocytes and NK cells and regulates eosinophils, affecting their survival, differentiation and chemotaxis.In addition, IL-5 stimulates immunoglobulin production, growth, and differentiation of activated and resting B cells.IL-5 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-5 protein, expressed by HEK293 , with C-6*His labeled tag.

IL-5 Protein, a homodimeric cytokine predominantly expressed by T-lymphocytes and NK cells, plays a pivotal role in the regulation of eosinophils by influencing their survival, differentiation, and chemotaxis. Additionally, IL-5 acts on both activated and resting B-cells, stimulating immunoglobulin production, growth, and differentiation. Mechanistically, the biological effects of IL-5 are mediated through a receptor complex composed of the IL5RA subunit and the cytokine receptor common subunit beta/CSF2RB. Upon binding to the receptor, IL-5 triggers the activation of various kinases, including LYN, SYK, and JAK2, thus propagating signals through the RAS-MAPK and JAK-STAT5 pathways (By similarity). Structurally, IL-5 forms a homodimer that is disulfide-linked and interacts with its receptor components IL5RA and CSF2RB, highlighting the specificity and complexity of its molecular interactions in orchestrating immune responses.

Mouse

HEK293

C-6*His

P04401 (M21-G133)

16191  [NCBI]

MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG

14-26 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.