1. Recombinant Proteins
  2. Others
  3. Clusterin/APOJ Protein, Human (HEK293, Fc-His)

Clusterin/APOJ Protein, Human (HEK293, Fc-His)

Cat. No.: HY-P7535
COA Handling Instructions

Clusterin/APOJ Protein, Human (HEK293, Fc-His) expresses in HEK293 with an Fc fragment and a His tag at the N-terminus. Apolipoprotein J (ApoJ) is involved in numerous physiological process important for lipid transportation, vascular smooth muscle cell differentiation, and has the potential for atherosclerosis.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $55 In-stock
10 μg $90 In-stock
50 μg $250 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Clusterin/APOJ Protein, Human (HEK293, Fc-His) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Clusterin/APOJ Protein, Human (HEK293, Fc-His) expresses in HEK293 with an Fc fragment and a His tag at the N-terminus. Apolipoprotein J (ApoJ) is involved in numerous physiological process important for lipid transportation, vascular smooth muscle cell differentiation, and has the potential for atherosclerosis[1].

Background

Apolipoprotein J (apoJ), also known as clusterin (CLU), which is tightly associated with both lipid and apoAl in HDLs in blood, has been proposed as such biomarker through numerous researches. In the process of relieving atherosclerosis, apoJ can promote cholesterol and phospholipid export from macrophage-foam cells, and exhibit cytoprotective and anti-inflammatory actions by interacting with lots of known inflammatory proteins which may predict the onset of clinical cardiovascular events and may actually play a causal role in mediating atherosclerotic disease such as C-reactive protein, paraoxonase, and leptin[1].

Biological Activity

Measured by its ability to induce clustering of Caki-2 human clear cell carcinoma epithelial cells.

Species

Human

Source

HEK293

Tag

C-hFc;C-6*His

Accession

P10909-1 (D23-E449)

Gene ID
Molecular Construction
N-term
Clusterin (D23-E449)
Accession # P10909
hFc-6*His
C-term
Synonyms
rHuApolipoprotein J, C-Fc-His; ApoJ; Clusterin; CLU; CLI; KUB1; Apolipoprotein J
AA Sequence

DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE

Molecular Weight

Approximately (35-40) & (61-79) & (95-100) kD

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4 or PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Clusterin/APOJ Protein, Human (HEK293, Fc-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Clusterin/APOJ Protein, Human (HEK293, Fc-His)
Cat. No.:
HY-P7535
Quantity:
MCE Japan Authorized Agent: