1. Recombinant Proteins
  2. Others
  3. Cofilin-1 Protein, Human (His)

Cofilin-1 Protein, Human (His)

Cat. No.: HY-P75682
SDS COA Handling Instructions

Cofilin-1 protein has pH-sensitive F-actin depolymerizing activity and can bind to F-actin. It cooperates with the subcortical maternal complex (SCMC) to guide the fertilized egg through initial embryonic cell division by regulating actin dynamics. Cofilin-1 Protein, Human (His) is the recombinant human-derived Cofilin-1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of Cofilin-1 Protein, Human (His) is 166 a.a., with molecular weight of ~21 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $35 In-stock
10 μg $60 In-stock
50 μg $165 In-stock
100 μg $280 In-stock
500 μg $780 In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Cofilin-1 protein has pH-sensitive F-actin depolymerizing activity and can bind to F-actin. It cooperates with the subcortical maternal complex (SCMC) to guide the fertilized egg through initial embryonic cell division by regulating actin dynamics. Cofilin-1 Protein, Human (His) is the recombinant human-derived Cofilin-1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of Cofilin-1 Protein, Human (His) is 166 a.a., with molecular weight of ~21 kDa.

Background

Cofilin-1 protein exhibits pH-sensitive F-actin depolymerizing activity by binding to F-actin. In collaboration with the subcortical maternal complex (SCMC), it plays a crucial role in enabling zygotes to progress beyond the initial embryonic cell divisions through the regulation of actin dynamics. Additionally, Cofilin-1 is essential for the centralization of the mitotic spindle and symmetric division of zygotes. In epithelial cells, it contributes to the regulation of cell morphology and cytoskeletal organization. Furthermore, Cofilin-1 is required for the up-regulation of the atypical chemokine receptor ACKR2, facilitating its efficient translocation from endosomal compartments to the cell membrane, thereby enhancing chemokine uptake and degradation. Its involvement extends to neural tube morphogenesis and neural crest cell migration. Functionally, Cofilin-1 can bind G- and F-actin in a 1:1 ratio, constituting a major component of intranuclear and cytoplasmic actin rods. Interactions with the subcortical maternal complex involve TLE6 isoform 1 and NLRP5, along with interaction with C9orf72.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P23528 (M1-L166)

Gene ID
Molecular Construction
N-term
6*His
Cofilin-1 (M1-L166)
Accession # P23528
C-term
Synonyms
Cofilin-1; 18 kDa phosphoprotein; p18; CFL1; CFL
AA Sequence

MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL

Molecular Weight

Approximately 21 kDa

Purity
  • Greater than 90 % as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of sterile 50 mM Tris-HCL, 300 mM NaCl, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Cofilin-1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cofilin-1 Protein, Human (His)
Cat. No.:
HY-P75682
Quantity:
MCE Japan Authorized Agent: