Cofilin-1 Protein, Human (His)

Cofilin-1 protein has pH-sensitive F-actin depolymerizing activity and can bind to F-actin. It cooperates with the subcortical maternal complex (SCMC) to guide the fertilized egg through initial embryonic cell division by regulating actin dynamics. Cofilin-1 Protein, Human (His) is the recombinant human-derived Cofilin-1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of Cofilin-1 Protein, Human (His) is 166 a.a., with molecular weight of ~21 kDa.

Cofilin-1 protein exhibits pH-sensitive F-actin depolymerizing activity by binding to F-actin. In collaboration with the subcortical maternal complex (SCMC), it plays a crucial role in enabling zygotes to progress beyond the initial embryonic cell divisions through the regulation of actin dynamics. Additionally, Cofilin-1 is essential for the centralization of the mitotic spindle and symmetric division of zygotes. In epithelial cells, it contributes to the regulation of cell morphology and cytoskeletal organization. Furthermore, Cofilin-1 is required for the up-regulation of the atypical chemokine receptor ACKR2, facilitating its efficient translocation from endosomal compartments to the cell membrane, thereby enhancing chemokine uptake and degradation. Its involvement extends to neural tube morphogenesis and neural crest cell migration. Functionally, Cofilin-1 can bind G- and F-actin in a 1:1 ratio, constituting a major component of intranuclear and cytoplasmic actin rods. Interactions with the subcortical maternal complex involve TLE6 isoform 1 and NLRP5, along with interaction with C9orf72.

Human

E. coli

N-6*His

P23528 (M1-L166)

1072  [NCBI]

MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL

Approximately 21 kDa

• 
  Greater than 90 % as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of sterile 50 mM Tris-HCL, 300 mM NaCl, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.