Complement C8G Protein, Human (His)

C8G/C8 γ is the γ subunit of the C8 protein of the complement system and is mainly localized in brain astrocytes. C8G/C8 γ is a neuroinflammation inhibitor that interacts with S1PR2 and jointly antagonizes the pro-inflammatory activity of S1P in microglia. Complement C8G Protein, Human (His) is the recombinant human-derived Complement C8G protein, expressed by E. coli , with N-6*His labeled tag. The total length of Complement C8G Protein, Human (His) is 182 a.a., with molecular weight of ~22.0 kDa.

C8G/C8 γ is the γ subunit of the C8 protein of the complement system and is mainly localized in brain astrocytes. The C8 protein is one of five components (C5b, C6, C7, C8, C9) that interact to form the complement cytolytic membrane attack complex (MAC). Can bind to the C5B-7 complex to form the C5B-8 complex. C5-B8 binds to C9 and acts as a catalyst in C9 polymerization. C8γ is unique in that it belongs to the lipocalin family of small secreted proteins and has the ability to bind small hydrophobic ligands. Cysteine residues of C8γ can bind to disulfide bonds of C8α and have inhibitory effects in neuroinflammation. In Alzheimer's disease patients with intense neuroinflammation, C8G levels are higher in brain tissue, cerebrospinal fluid, and plasma. Use of recombinant C8G protein inhibits glial hyperactivation, neuroinflammation, and cognitive decline in animal models of acute and chronic Alzheimer's disease. S1PR2 is a novel interacting protein of C8G, and together they antagonize the proinflammatory effects of S1P in microglia.

Human

E. coli

N-6*His

AAI13627.1 (Q21-R202)

733  [NCBI]

QKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARDARGAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEVRR

Approximately 22.0-23.0 kDa

Greater than 90% as determined by reducing SDS-PAGE

Solution

Supplied as a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.