CTLA-4 Protein, Mouse (HEK293, Fc)

CTLA-4 is a key inhibitory receptor that serves as a major negative regulator of T cell responses in immune regulation. Its unique property is that its affinity to B7 ligands (CD80/CD86) is significantly higher than that of CD28. CTLA-4 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CTLA-4 protein, expressed by HEK293 , with C-hFc labeled tag.

CTLA-4, a pivotal inhibitory receptor, acts as a primary negative regulator in T-cell responses, exerting its influence within the intricate network of immune modulation. This regulatory function arises from the distinct property of CTLA-4, showcasing significantly heightened affinity for its natural B7 family ligands, CD80 and CD86, in comparison to the cognate stimulatory coreceptor CD28. The homodimeric structure of CTLA-4, intricately linked by disulfide bonds, underscores its role as a molecular sentinel in immune regulation. Functionally, CTLA-4 binds avidly to CD80/B7-1 and CD86/B7.2, competitively engaging with these ligands to suppress T-cell activation and finely tune immune responses. Additionally, CTLA-4 interacts with ICOSLG, contributing to its multifaceted engagement in immune checkpoint pathways.

Measured by its ability to inhibit IL-2 secretion by stimulated Jurkat human acute T cell leukemia cells. The ED₅₀ for this effect is 0.286 µg/mL when stimulated with 1 µg/mL Recombinant Human B7-1(HY-P7321) in the presence of PHA, corresponding to a specific activity is 3.496×10⁴ U/mg.

Mouse

HEK293

C-hFc

P09793 (A37-D161)

12477  [NCBI]

AIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD

Approximately 50-60 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.