1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. IL-8/CXCL8
  6. CXCL8 Protein, Rhesus macaque (His)

CXCL8 Protein, Rhesus macaque (His)

Cat. No.: HY-P71904A
COA Handling Instructions

CXCL8 protein, a crucial chemotactic factor, drives inflammatory responses by attracting neutrophils, basophils, and T-cells, contributing to pathogen clearance. It plays a pivotal role in activating neutrophils and binds to CXCR1/CXCR2 receptors, initiating downstream signaling pathways. CXCL8 homodimerizes and interacts with TNFAIP6, potentially regulating chemokine activity in the inflammatory microenvironment. CXCL8 Protein, Rhesus macaque (His) is the recombinant Rhesus Macaque-derived CXCL8 protein, expressed by E. coli , with N-6*His labeled tag. The total length of CXCL8 Protein, Rhesus macaque (His) is 79 a.a., with molecular weight of ~11 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $35 In-stock
10 μg $60 In-stock
50 μg $170 In-stock
100 μg $290 In-stock
500 μg $815 In-stock
1 mg $1400 In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CXCL8 protein, a crucial chemotactic factor, drives inflammatory responses by attracting neutrophils, basophils, and T-cells, contributing to pathogen clearance. It plays a pivotal role in activating neutrophils and binds to CXCR1/CXCR2 receptors, initiating downstream signaling pathways. CXCL8 homodimerizes and interacts with TNFAIP6, potentially regulating chemokine activity in the inflammatory microenvironment. CXCL8 Protein, Rhesus macaque (His) is the recombinant Rhesus Macaque-derived CXCL8 protein, expressed by E. coli , with N-6*His labeled tag. The total length of CXCL8 Protein, Rhesus macaque (His) is 79 a.a., with molecular weight of ~11 kDa.

Background

CXCL8 protein functions as a critical chemotactic factor that orchestrates the inflammatory response by attracting neutrophils, basophils, and T-cells, thereby aiding in the clearance of pathogens and safeguarding the host from infections. Additionally, CXCL8 plays a pivotal role in activating neutrophils. Upon release in response to inflammatory stimuli, CXCL8 exerts its effects by binding to the G-protein-coupled receptors CXCR1 and CXCR2, predominantly present in neutrophils, monocytes, and endothelial cells. The G-protein heterotrimer (alpha, beta, gamma subunits) constitutively binds to the CXCR1/CXCR2 receptor, and activation by CXCL8 results in the release of beta and gamma subunits from Galpha (GNAI2 in neutrophils), subsequently activating various downstream signaling pathways, including PI3K and MAPK pathways. CXCL8 forms homodimers, and its interaction with TNFAIP6 via the Link domain interferes with chemokine binding to glycosaminoglycans, suggesting a regulatory role in modulating chemokine activity within the inflammatory microenvironment.

Biological Activity

Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells.The ED50 for this effect is 8.054-11.39 ng/mL, corresponding to a specific activity is 1.24×105 to 8.78×104 units/mg.

  • Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells.The ED50 for this effect is 8.054-11.39 ng/mL, corresponding to a specific activity is 1.24×105 to 8.78×104 units/mg.
Species

Rhesus Macaque

Source

E. coli

Tag

N-6*His

Accession

P67813 (A23-P101)

Gene ID
Molecular Construction
N-term
6*His
CXCL8 (A23-P101)
Accession # P67813
C-term
Synonyms
CXCL8; IL8Interleukin-8; IL-8; C-X-C motif chemokine 8; Chemokine; C-X-C motif; ligand 8
AA Sequence

AVLPRSAKELRCECIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKEPWVQRVVEKFVKRAENQNP

Molecular Weight

Approximately 11 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CXCL8 Protein, Rhesus macaque (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CXCL8 Protein, Rhesus macaque (His)
Cat. No.:
HY-P71904A
Quantity:
MCE Japan Authorized Agent: