1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Protease Inhibitors Cystatin Family
  4. Cystatin C
  5. Cystatin C/CST3 Protein, Rat (HEK293, His)

Cystatin C/CST3 protein is a vital regulator of cysteine proteinases, inhibiting enzymes like cathepsin B, H, and L to ensure proper enzyme activity.Its role as a local regulator underscores its significance in various biological processes.Cystatin C/CST3 Protein, Rat (HEK293, His) is the recombinant rat-derived Cystatin C/CST3 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Cystatin C/CST3 protein is a vital regulator of cysteine proteinases, inhibiting enzymes like cathepsin B, H, and L to ensure proper enzyme activity.Its role as a local regulator underscores its significance in various biological processes.Cystatin C/CST3 Protein, Rat (HEK293, His) is the recombinant rat-derived Cystatin C/CST3 protein, expressed by HEK293 , with C-His labeled tag.

Background

Cystatin C, also known as CST3 protein, is a crucial regulator of cysteine proteinases. This protein acts as an inhibitor, specifically targeting enzymes such as cathepsin B, H, and L, to maintain proper enzyme activity. Its physiological role as a local regulator highlights its significance in various biological processes.

Biological Activity

Measured by its ability to inhibit papain cleavage of a fluorogenic peptide substrate Z-FR-AMC. Read at excitation and emission wavelengths of 380 nm and 460 nm (top read). The IC50 value is 5.37 nM.

Species

Rat

Source

HEK293

Tag

C-His

Accession

P14841 (M1-A140)

Gene ID
Molecular Construction
N-term
CST3 (M1-A140)
Accession # P14841
His
C-term
Synonyms
Cystatin-C; Cystatin-3; Cst3
AA Sequence

GTSRPPPRLLGAPQEADASEEGVQRALDFAVSEYNKGSNDAYHSRAIQVVRARKQLVAGINYYLDVEMGRTTCTKSQTNLTNCPFHDQPHLMRKALCSFQIYSVPWKGTHTLTKSSCKNA

Molecular Weight

16-25 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM HEPES, 150 mM NaCl, pH 7.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Cystatin C/CST3 Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cystatin C/CST3 Protein, Rat (HEK293, His)
Cat. No.:
HY-P74209
Quantity:
MCE Japan Authorized Agent: