1. Recombinant Proteins
  2. Others
  3. EIF1 Protein, Human (GST)

The EIF1 protein is a key member of the 43S preinitiation complex (43S PIC), binding to the mRNA cap-proximal region, scanning the 5′-untranslated region, and localizing the initiation codon. EIF1 Protein, Human (GST) is the recombinant human-derived EIF1 protein, expressed by E. coli , with N-GST labeled tag. The total length of EIF1 Protein, Human (GST) is 113 a.a., with molecular weight of 39.7 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The EIF1 protein is a key member of the 43S preinitiation complex (43S PIC), binding to the mRNA cap-proximal region, scanning the 5′-untranslated region, and localizing the initiation codon. EIF1 Protein, Human (GST) is the recombinant human-derived EIF1 protein, expressed by E. coli , with N-GST labeled tag. The total length of EIF1 Protein, Human (GST) is 113 a.a., with molecular weight of 39.7 kDa.

Background

EIF1 is a vital component of the 43S pre-initiation complex (43S PIC) and plays a crucial role in the intricate process of translation initiation. As part of the 43S PIC, EIF1 binds to the mRNA cap-proximal region, engages in mRNA scanning, and precisely locates the initiation codon. Teaming up with eIF1A (EIF1AX), EIF1 is indispensable for the recognition of the start codon, dependent on the AUG nucleotide context and its position relative to the 5'-cap. EIF1 actively contributes to initiation codon selection by influencing the conformation of the 40S ribosomal subunit and the positioning of the bound mRNA and initiator tRNA. It regulates the opening and closing of the mRNA binding channel, ensuring mRNA recruitment, scanning, and the accuracy of initiation codon selection. Continuously surveilling and guarding against premature and partial base-pairing of codons in the 5'-UTR with the anticodon of the initiator tRNA, EIF1, together with eIF1A (EIF1AX), orchestrates ribosomal scanning, promotes the assembly of the 48S complex at the initiation codon, and facilitates the dissociation of aberrant complexes. Interaction with EIF4G1 supports ribosome scanning, leaky scanning, and discrimination against cap-proximal AUG. Maintaining an open conformation within the 43S PIC through interaction with EIF1A-EIF5, EIF1 undergoes a conformational shift upon reaching the correct start codon, moving the PIC into a closed conformation and halting it at the start codon. This multifaceted role highlights EIF1's essential contributions to the precision and fidelity of translation initiation.

Species

Human

Source

E. coli

Tag

N-GST

Accession

P41567 (M1-F113)

Gene ID
Molecular Construction
N-term
GST
EIF1 (M1-F113)
Accession # P41567
C-term
Synonyms
eukaryotic translation initiation factor 1; A121; EIF 1; EIF1A; ISO1; SUI1; EIF-1;
AA Sequence

MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF

Molecular Weight

39.7 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

EIF1 Protein, Human (GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EIF1 Protein, Human (GST)
Cat. No.:
HY-P700519
Quantity:
MCE Japan Authorized Agent: