EIF1AX Protein, Human (His)

The EIF1AX protein is an important member of the 43S preinitiation complex (43S PIC) and is responsible for coordinating mRNA cap-proximal binding, scanning the 5'-untranslated region, and pinpointing the start codon. EIF1AX Protein, Human (His) is the recombinant human-derived EIF1AX protein, expressed by E. coli , with N-6*His labeled tag. The total length of EIF1AX Protein, Human (His) is 144 a.a., with molecular weight of ~22.0 kDa.

EIF1AX is a crucial component of the 43S pre-initiation complex (43S PIC), playing a pivotal role in the initiation of protein synthesis. As part of the 43S PIC, EIF1AX binds to the mRNA cap-proximal region, facilitates scanning of the mRNA 5'-untranslated region, and locates the initiation codon. Working in concert with EIF1, EIF1AX enhances the formation of the cap-proximal complex and aids in scanning, start codon recognition, assembly of the 48S complex at the initiation codon, and dissociation of aberrant complexes. Following the location of the start codon, EIF1AX collaborates with EIF5B to orient the initiator methionine-tRNA in a conformation conducive to 60S ribosomal subunit joining, forming the 80S initiation complex. EIF1AX is released after 80S initiation complex formation, occurring just after GTP hydrolysis by EIF5B and preceding the release of EIF5B. Its globular part is situated in the A site of the 40S ribosomal subunit. Interactions with EIF5 and EIF5B during scanning contribute to the maintenance of EIF1 within the open 43S PIC, highlighting EIF1AX's multifaceted role in the complex process of translation initiation.

Human

E. coli

N-6*His

P47813 (M1-I144)

1964  [NCBI]

MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI

Approximately 22.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.