1. Recombinant Proteins
  2. Others
  3. EIF1B Protein, Human (His)

EIF1B Protein likely intricately participates in translation, playing a crucial role in facilitating accurate and efficient protein synthesis within cellular machinery. Its involvement suggests a key function in orchestrating various steps required for proper decoding of mRNA and subsequent assembly of polypeptide chains. EIF1B Protein, Human (His) is the recombinant human-derived EIF1B protein, expressed by E. coli , with N-6*His labeled tag. The total length of EIF1B Protein, Human (His) is 113 a.a., with molecular weight of ~16.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

EIF1B Protein likely intricately participates in translation, playing a crucial role in facilitating accurate and efficient protein synthesis within cellular machinery. Its involvement suggests a key function in orchestrating various steps required for proper decoding of mRNA and subsequent assembly of polypeptide chains. EIF1B Protein, Human (His) is the recombinant human-derived EIF1B protein, expressed by E. coli , with N-6*His labeled tag. The total length of EIF1B Protein, Human (His) is 113 a.a., with molecular weight of ~16.0 kDa.

Background

EIF1B protein is likely intricately involved in the complex process of translation, playing a crucial role in facilitating the accurate and efficient synthesis of proteins within the cellular machinery. Its participation in translation suggests a key function in orchestrating the various steps required for the proper decoding of mRNA and subsequent assembly of polypeptide chains.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

O60739 (M1-F113)

Gene ID
Molecular Construction
N-term
6*His
EIF1B (M1-F113)
Accession # O60739
C-term
Synonyms
rHuEukaryotic translation initiation factor 1b/EIF1B, His; Eukaryotic Translation Initiation Factor 1b; eIF1b; Protein Translation Factor SUI1 Homolog GC20; EIF1B
AA Sequence

MSTIQNLQSFDPFADATKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF

Molecular Weight

Approximately 16.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

EIF1B Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EIF1B Protein, Human (His)
Cat. No.:
HY-P70207
Quantity:
MCE Japan Authorized Agent: