1. Recombinant Proteins
  2. Others
  3. EIF5 Protein, Human (His)

The EIF5 protein is a key member of the 43S pre-initiation complex (43S PIC) and actively participates in mRNA cap-proximal binding, scanning 5'-untranslated regions and locating start codons. EIF5 Protein, Human (GST) is the recombinant human-derived EIF5 protein, expressed by E. coli , with N-GST labeled tag. The total length of EIF5 Protein, Human (GST) is 150 a.a., with molecular weight of 38-43 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The EIF5 protein is a key member of the 43S pre-initiation complex (43S PIC) and actively participates in mRNA cap-proximal binding, scanning 5'-untranslated regions and locating start codons. EIF5 Protein, Human (GST) is the recombinant human-derived EIF5 protein, expressed by E. coli , with N-GST labeled tag. The total length of EIF5 Protein, Human (GST) is 150 a.a., with molecular weight of 38-43 kDa.

Background

EIF5 serves as a crucial component of the 43S pre-initiation complex (43S PIC), participating in the initiation of protein synthesis. Within this complex, EIF5 plays a key role in mRNA scanning, start codon recognition, and GTP hydrolysis. Acting as a GTPase-activating protein, EIF5 promotes the hydrolysis of GTP by eIF2G (EIF2S3). During the scanning process, EIF5 interacts with both EIF1 and EIF1A, contributing to the maintenance of EIF1 within the open 43S PIC. Upon recognition of the start codon, EIF5 induces eIF2G (EIF2S3) to hydrolyze GTP and initiates a conformational change in the PIC to a closed state. This change enhances the affinity of EIF5-CTD for EIF2-beta (EIF2S2), leading to the release of EIF1 from the PIC. Finally, EIF5 stabilizes the PIC in its closed conformation. EIF5 interacts with various components of the translation machinery, including EIF1A, EIF2-beta (EIF2S2), and EIF5B, as well as with FMR1 isoform 6 in a RNA-dependent manner, highlighting its multifaceted involvement in protein synthesis initiation.

Species

Human

Source

E. coli

Tag

N-His

Accession

P55010 (M1-D150)

Gene ID
Molecular Construction
N-term
GST
EIF5 (M1-D150)
Accession # P55010
C-term
Synonyms
Eukaryotic translation initiation factor 5; eIF-5
AA Sequence

MSVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVKNDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTFILKNPPENSD

Molecular Weight

Approximately 18 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

EIF5 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EIF5 Protein, Human (His)
Cat. No.:
HY-P75255
Quantity:
MCE Japan Authorized Agent: