EIF5A Protein, Human (His)

The GSK-3 beta protein is an enzyme that plays a crucial role in multiple cellular processes, including cell proliferation, differentiation, and apoptosis. It regulates various signaling pathways and is involved in the development of several diseases, such as cancer and neurodegenerative disorders. GSK-3 beta is active in its unphosphorylated form and can phosphorylate a wide range of substrates to modulate cellular functions. EIF5A Protein, Human (His) is the recombinant human-derived EIF5A protein, expressed by E. coli , with N-6*His labeled tag. The total length of EIF5A Protein, Human (His) is 154 a.a., with molecular weight of ~19 kDa.

The EIF5A Protein is characterized by its ability to enable U6 snRNA binding activity and protein N-terminus binding activity. It plays a role in diverse cellular processes, including the cellular response to viruses, positive regulation of the intrinsic apoptotic signaling pathway by p53 class mediator, and the tumor necrosis factor-mediated signaling pathway. The protein is found in annulate lamellae, cytoplasm, and the nucleus, with a specific association with the nuclear pore. Notably, the EIF5A gene demonstrates ubiquitous expression, with elevated levels detected in the esophagus (RPKM 53.8), appendix (RPKM 49.4), and 25 other tissues, suggesting its involvement in various physiological contexts across a broad spectrum of tissues. [Information provided by Alliance of Genome Resources, April 2022]

Human

E. coli

N-6*His

NP_001961 (M1-K154)

1984  [NCBI]

MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAK

Approximately 19 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 300 mM NaCl, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween80.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For lower concentration,please reconstitute in 50 mM Tris-HCL,300 mM NaCl, pH 7.4 buffer.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.