Ephrin-A3/EFNA3 Protein, Mouse (HEK293, Fc)

Ephrin-A3/EFNA3 Protein, a GPI-bound ligand, interacts with Eph receptors, playing a critical role in neuronal, vascular, and epithelial development. It binds adjacent Eph receptors, initiating bidirectional signaling. Ephrin-A3/EFNA3 also activates EPHA8, contributing to its regulatory functions in migration, repulsion, and adhesion. Ephrin-A3/EFNA3 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Ephrin-A3/EFNA3 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Ephrin-A3/EFNA3 Protein, Mouse (HEK293, Fc) is 184 a.a., with molecular weight of 61-70 kDa.

Ephrin-A3/EFNA3 Protein is a cell surface GPI-bound ligand that plays a critical role in neuronal, vascular, and epithelial development by interacting with Eph receptors, a family of receptor tyrosine kinases involved in migration, repulsion, and adhesion. It binds promiscuously to Eph receptors on adjacent cells, initiating contact-dependent bidirectional signaling. The receptor's downstream signaling is known as forward signaling, while the ephrin ligand's downstream signaling is referred to as reverse signaling. Ephrin-A3/EFNA3 also interacts with EPHA8 and activates this receptor, further contributing to its regulatory functions.

Mouse

HEK293

C-hFc

O08545 (Q23-G206)

13638  [NCBI]

QGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGPGGGAEQYVLYMVNLSGYRTCNASQGSKRWECNRQHASHSPIKFSEKFQRYSAFSLGYEFHAGQEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSISG

61-70 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.