Ephrin-B2/EFNB2 Protein, Canine (HEK293, His)

Ephrin-B2/EFNB2 Protein, a member of the ephrin family, serves as a transmembrane ligand, interacting with its Eph receptor to initiate bidirectional signaling. Crucial in developmental processes like tissue boundary formation, axon guidance, angiogenesis, and synaptic plasticity, Ephrin-B2/EFNB2 is implicated in conditions like cancer, cardiovascular diseases, and neurological disorders, making it a potential therapeutic target. Ephrin-B2/EFNB2 Protein, Canine (HEK293, His) is the recombinant canine-derived Ephrin-B2/EFNB2 protein, expressed by HEK293, with C-His labeled tag. The total length of Ephrin-B2/EFNB2 Protein, Canine (HEK293, His) is 202 a.a., with molecular weight of ~25-35 kDa.

Ephrin-B2/EFNB2 protein is a member of the ephrin family, a group of proteins that play important roles in cellular signaling and communication. Ephrin-B2/EFNB2 specifically functions as a transmembrane ligand, interacting with its corresponding Eph receptor to initiate bidirectional signaling events that regulate diverse cellular processes. This protein is involved in various developmental processes, including tissue boundary formation, axon guidance, angiogenesis, and synaptic plasticity. Additionally, Ephrin-B2/EFNB2 has been implicated in pathological conditions such as cancer, cardiovascular diseases, and neurological disorders, making it a potential therapeutic target for intervention.

Immobilized canine EFNB2-His at 10 μg/mL (100 μL /well) can bind Human EphB4. The ED₅₀ for this effect is 16.44 ng/mL.

• 
  Immobilized canine EFNB2-His at 10 μg/mL (100 μL /well) can bind Human EphB4. The ED₅₀ for this effect is 16.44 ng/mL.

Canine

HEK293

C-His

B0LDS6 (I28-A229)

611745  [NCBI]

IVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLNCARPDQDVKFTIKFQEFSPNLWGLEFQKNRDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGQDASSAGSARHNDPTRRPELEAGTNGRSSTTSPFVKPNPGSSTDGSSAGHSGNNILGSEVALFA

The protein migrates as approximately 25-35 kDa under reducing SDS-PAGE due to glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.