1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Ephrin/Eph Family
  4. Ephrins
  5. Ephrin B2
  6. Ephrin-B2/EFNB2 Protein, Canine (HEK293, His)

Ephrin-B2/EFNB2 Protein, a member of the ephrin family, serves as a transmembrane ligand, interacting with its Eph receptor to initiate bidirectional signaling. Crucial in developmental processes like tissue boundary formation, axon guidance, angiogenesis, and synaptic plasticity, Ephrin-B2/EFNB2 is implicated in conditions like cancer, cardiovascular diseases, and neurological disorders, making it a potential therapeutic target. Ephrin-B2/EFNB2 Protein, Canine (HEK293, His) is the recombinant canine-derived Ephrin-B2/EFNB2 protein, expressed by HEK293, with C-His labeled tag. The total length of Ephrin-B2/EFNB2 Protein, Canine (HEK293, His) is 202 a.a., with molecular weight of ~25-35 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Ephrin-B2/EFNB2 Protein, a member of the ephrin family, serves as a transmembrane ligand, interacting with its Eph receptor to initiate bidirectional signaling. Crucial in developmental processes like tissue boundary formation, axon guidance, angiogenesis, and synaptic plasticity, Ephrin-B2/EFNB2 is implicated in conditions like cancer, cardiovascular diseases, and neurological disorders, making it a potential therapeutic target. Ephrin-B2/EFNB2 Protein, Canine (HEK293, His) is the recombinant canine-derived Ephrin-B2/EFNB2 protein, expressed by HEK293, with C-His labeled tag. The total length of Ephrin-B2/EFNB2 Protein, Canine (HEK293, His) is 202 a.a., with molecular weight of ~25-35 kDa.

Background

Ephrin-B2/EFNB2 protein is a member of the ephrin family, a group of proteins that play important roles in cellular signaling and communication. Ephrin-B2/EFNB2 specifically functions as a transmembrane ligand, interacting with its corresponding Eph receptor to initiate bidirectional signaling events that regulate diverse cellular processes. This protein is involved in various developmental processes, including tissue boundary formation, axon guidance, angiogenesis, and synaptic plasticity. Additionally, Ephrin-B2/EFNB2 has been implicated in pathological conditions such as cancer, cardiovascular diseases, and neurological disorders, making it a potential therapeutic target for intervention.

Biological Activity

Immobilized canine EFNB2-His at 10 μg/mL (100 μL /well) can bind Human EphB4. The ED50 for this effect is 16.44 ng/mL.

  • Immobilized canine EFNB2-His at 10 μg/mL (100 μL /well) can bind Human EphB4. The ED50 for this effect is 16.44 ng/mL.
Species

Canine

Source

HEK293

Tag

C-His

Accession

B0LDS6 (I28-A229)

Gene ID
Molecular Construction
N-term
EFNB2 (I28-A229)
Accession # B0LDS6
His
C-term
Synonyms
Ephrin-B2; LERK-5; HTK-L; EFNB2; EPLG5
AA Sequence

IVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLNCARPDQDVKFTIKFQEFSPNLWGLEFQKNRDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGQDASSAGSARHNDPTRRPELEAGTNGRSSTTSPFVKPNPGSSTDGSSAGHSGNNILGSEVALFA

Molecular Weight

The protein migrates as approximately 25-35 kDa under reducing SDS-PAGE due to glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Ephrin-B2/EFNB2 Protein, Canine (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Ephrin-B2/EFNB2 Protein, Canine (HEK293, His)
Cat. No.:
HY-P75230
Quantity:
MCE Japan Authorized Agent: