Epiregulin Protein, Human (HEK293, Fc)

Epiregulin Protein, a ligand for EGFR and ERBB4, crucially influences inflammation, wound healing, tissue repair, and oocyte maturation. It stimulates tyrosine phosphorylation of both receptors, regulating angiogenesis, vascular remodeling, and cell proliferation. Interactions with EGFR and ERBB4 contribute to intricate signaling pathways, essential for diverse physiological responses and cellular functions. Epiregulin Protein, Human (HEK293, Fc) is the recombinant human-derived Epiregulin protein, expressed by HEK293 , with N-hFc labeled tag.

Epiregulin, a ligand for the EGF receptor (EGFR) and ERBB4, plays a crucial role in cellular processes such as inflammation, wound healing, tissue repair, and oocyte maturation. It achieves this by stimulating the tyrosine phosphorylation of both EGFR and ERBB4. Additionally, epiregulin is involved in the regulation of angiogenesis, vascular remodeling, and cell proliferation. Through its interactions with EGFR and ERBB4, epiregulin contributes to intricate signaling pathways that are essential for various physiological responses and cellular functions.

Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED₅₀ for this effect is <8 μg/mL.

• 
  Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED₅₀ for this effect is 0.7141 ng/mL, corresponding to a specific activity is 1.4×10⁶ units/mg.

Human

HEK293

N-hFc

O14944/NP_001423.1 (V63-L108)

2069  [NCBI]

VSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFL

Approximately 35 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.