1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Erythropoietin/EPO Protein, Human (CHO)

Erythropoietin/EPO Protein, Human (CHO)

Cat. No.: HY-P7164
SDS COA Handling Instructions

Erythropoietin/EPO Protein, Human (CHO) protects the myocardium from ischemia-reperfusion injury and promotes beneficial remodeling.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $35 In-stock
10 μg $80 In-stock
50 μg $190 In-stock
100 μg $320 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE Erythropoietin/EPO Protein, Human (CHO)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Erythropoietin/EPO Protein, Human (CHO) protects the myocardium from ischemia-reperfusion injury and promotes beneficial remodeling.

Background

Erythropoietin (EPO), originally identified for its critical hormonal role in promoting erythrocyte survival and differentiation, is a member of the large and diverse cytokine superfamily. EPO and EPOR function as the primary mediators of a general protective response to tissue hypoxia, which acts to maintain adequate tissue oxygenation through adjustments of circulating red cell mass by using a hormonal feedback-control system involving the kidney and the bone marrow. EPO and EPORs are also expressed by other tissues and organs, including the brain and heart. EPO has also been shown to stimulate mitosis and signaling in astrocytes, endothelial cells, cardiomyoblasts, and cardiomyocytes maintained in vitro[1].

Biological Activity

The ED50 is ≤2.299 ng/mL as measured in a cell proliferation assay using TF-1 human erythroleukemic cells, corresponding to a specific activity of ≥4.350× 105 units/mg.

  • Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 1.136 ng/mL, corresponding to a specific activity is 8.803×105 U/mg
Species

Human

Source

CHO

Tag

Tag Free

Accession

P01588 (A28-R193)

Gene ID
Molecular Construction
N-term
EPO (A28-R193)
Accession # P01588
C-term
Synonyms
rHuEPO; Epoetin; EPO
AA Sequence

APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR

Molecular Weight

Approximately 26-38 kDa due to glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Erythropoietin/EPO Protein, Human (CHO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Erythropoietin/EPO Protein, Human (CHO)
Cat. No.:
HY-P7164
Quantity:
MCE Japan Authorized Agent: