Erythropoietin Protein, Rat (sf9, His)

Epo protein is a hormone that plays a vital role in regulating red blood cell production in the body.It stimulates the differentiation and maturation of red blood cells in the bone marrow.Erythropoietin Protein, Rat (sf9, His) is the recombinant rat-derived Erythropoietin protein, expressed by Sf9 insect cells , with C-His labeled tag.

Epo Protein is a hormone primarily responsible for regulating the proliferation and differentiation of erythrocytes, as well as maintaining a balanced level of circulating erythrocyte mass. It accomplishes this by binding to its receptor, EPOR, which leads to the dimerization of EPOR and subsequent activation of JAK2. This activation triggers a cascade of signaling events involving specific downstream effectors such as STAT1 and STAT3. These pathways, including the RAS-MAPK and JAK-STAT5 pathways, contribute to the diverse functions of Epo Protein. Additionally, Epo Protein exists as a homodimer connected by disulfide bonds.

Rat

Sf9 insect cells

C-His

P29676-1 (A27-R192)

24335  [NCBI]

MGVPERPTLLLLLSLLLIPLGLPVLCAPPRLICDSRVLERYILEAKEAENVTMGCAEGPRLSENITVPDTKVNFYAWKRMKVEEQAVEVWQGLSLLSEAILQAQALQANSSQPPESLQLHIDKAISGLRSLTSLLRVLGAQKELMSPPDATQAAPLRTLTADTFCKLFRVYSNFLRGKLKLYTGEACRRGDR

Approximately 27 kDa

Greater than 90% as determined by reducing SDS-PAGE

<1 EU/μg, determined by LAL method.