1. Recombinant Proteins
  2. Receptor Proteins
  3. Cell Adhesion Molecules (CAMs)
  4. Immunoglobulin-like Cell Adhesion Molecules
  5. Endothelial Cell-Selective Adhesion Molecule (ESAM)
  6. ESAM Protein, Human (HEK293, His)

ESAM Protein, Human (HEK293, His)

Cat. No.: HY-P70889
SDS COA Handling Instructions

ESAM, short for Endothelial Cell Selective Adhesion Molecule, has the ability to induce aggregation, possibly through homophilic molecular interactions. It plays a role in molecular communication by binding to MAGI1, possibly forming complexes that contribute to intercellular signaling and adhesion processes. ESAM Protein, Human (HEK293, His) is the recombinant human-derived ESAM protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg $93 In-stock
50 μg $260 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ESAM, short for Endothelial Cell Selective Adhesion Molecule, has the ability to induce aggregation, possibly through homophilic molecular interactions. It plays a role in molecular communication by binding to MAGI1, possibly forming complexes that contribute to intercellular signaling and adhesion processes. ESAM Protein, Human (HEK293, His) is the recombinant human-derived ESAM protein, expressed by HEK293 , with C-6*His labeled tag.

Background

ESAM, short for Endothelial cell-selective adhesion molecule, possesses the ability to induce aggregation, likely through a homophilic molecular interaction. It plays a role in molecular communication by engaging with MAGI1, potentially forming a complex that contributes to intercellular signaling and adhesion processes. Further investigation is necessary to elucidate the precise mechanisms and functions of ESAM and its interactions with MAGI1 in different physiological and pathological contexts.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q96AP7-1 (Q30-A247 )

Gene ID
Molecular Construction
N-term
ESAM (Q30-A247 )
Accession # Q96AP7-1
6*His
C-term
Synonyms
Endothelial Cell-Selective Adhesion Molecule; ESAM
AA Sequence

QLQLHLPANRLQAVEGGEVVLPAWYTLHGEVSSSQPWEVPFVMWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKDSGPYSCSVNVQDKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSLSLTNLSSSMAGVYVCKAHNEVGTAQCNVTLEVSTGPGA

Molecular Weight

Approximately 36.55 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ESAM Protein, Human (HEK293, His)
Cat. No.:
HY-P70889
Quantity:
MCE Japan Authorized Agent: