ESAM Protein, Human (HEK293, His)

ESAM, short for Endothelial Cell Selective Adhesion Molecule, has the ability to induce aggregation, possibly through homophilic molecular interactions. It plays a role in molecular communication by binding to MAGI1, possibly forming complexes that contribute to intercellular signaling and adhesion processes. ESAM Protein, Human (HEK293, His) is the recombinant human-derived ESAM protein, expressed by HEK293 , with C-6*His labeled tag.

ESAM, short for Endothelial cell-selective adhesion molecule, possesses the ability to induce aggregation, likely through a homophilic molecular interaction. It plays a role in molecular communication by engaging with MAGI1, potentially forming a complex that contributes to intercellular signaling and adhesion processes. Further investigation is necessary to elucidate the precise mechanisms and functions of ESAM and its interactions with MAGI1 in different physiological and pathological contexts.

Human

HEK293

C-6*His

Q96AP7-1 (Q30-A247 )

90952  [NCBI]

QLQLHLPANRLQAVEGGEVVLPAWYTLHGEVSSSQPWEVPFVMWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKDSGPYSCSVNVQDKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSLSLTNLSSSMAGVYVCKAHNEVGTAQCNVTLEVSTGPGA

Approximately 36.55 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.