FGF-1 Protein, Mouse

FGF-1 Protein, Mouse is a growth factor and signaling protein encoded by the FGF1 gene.

Acidic Fibroblast Growth Factor is involved in a wide spectrum of biological functions including tissue development and repair, angiogenesis, proliferation of both epithelial and mesenchymal cells, and tumorigenesis. The biological activities of Acidic Fibroblast Growth Factor depend on binding to highly specific cell surface receptors, among which, fibroblast growth factor receptor 4 (FGFR4) is highly specific^[1].

1.The ED₅₀ is <2 ng/mL as measured by Balb3T3 cells, corresponding to a specific activity of >5 × 10⁵ units/mg.
2.Measured in a cell proliferation assay using NIH-3T3 mouse embryonic fibroblasts cells. The ED₅₀ for this effect is ≤1.2 ng/mL in the presence of 10 µg/mL of heparin.

• 
  Measured in a cell proliferation assay using NIH3T3 cells. The ED₅₀ for this effect is 1.186 ng/mL in the presence of 10 µg/mL heparin, corresponding to a specific activity is 8.431×10⁵ units/mg.

Mouse

E. coli

Tag Free

P61148 (F16-D155)

14164  [NCBI]

FNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Approximately 15-23 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS pH 7.4 or PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween80 or PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. La Rosa S, et al. Expression of acidic fibroblast growth factor (aFGF) and fibroblast growth factor receptor 4 (FGFR4) in breast fibroadenomas. J Clin Pathol. 2001 Jan;54(1):37-41.  [Content Brief]