1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF Family
  4. Fibroblast Growth Factor
  5. Fibroblast Growth Factor 21 (FGF-21)
  6. FGF-21 Protein, Mouse (HEK293, His)

FGF-21 Proteinas influences glucose uptake in adipocytes by inducing SLC2A1/GLUT1 expression, particularly with KLB's presence. It plays a crucial role in systemic glucose homeostasis and insulin sensitivity, interacting directly with KLB through its C-terminus and engaging with FGFR4. The protein's molecular mechanisms involve a complex interplay, emphasizing its broad impact beyond localized effects. FGF-21 Protein, Mouse (HEK293, His) is the recombinant mouse-derived FGF-21 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of FGF-21 Protein, Mouse (HEK293, His) is 182 a.a., with molecular weight of 20-29 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FGF-21 Proteinas influences glucose uptake in adipocytes by inducing SLC2A1/GLUT1 expression, particularly with KLB's presence. It plays a crucial role in systemic glucose homeostasis and insulin sensitivity, interacting directly with KLB through its C-terminus and engaging with FGFR4. The protein's molecular mechanisms involve a complex interplay, emphasizing its broad impact beyond localized effects. FGF-21 Protein, Mouse (HEK293, His) is the recombinant mouse-derived FGF-21 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of FGF-21 Protein, Mouse (HEK293, His) is 182 a.a., with molecular weight of 20-29 kDa.

Background

FGF-21 protein exerts its biological influence by promoting glucose uptake in differentiated adipocytes, primarily through inducing the expression of the glucose transporter SLC2A1/GLUT1, rather than SLC2A4/GLUT4. This activity is likely contingent on the presence of KLB. Beyond its localized effects, FGF-21 plays a crucial role in the regulation of systemic glucose homeostasis and insulin sensitivity. The protein interacts directly with KLB, facilitated by its C-terminus, and also engages with FGFR4, indicating a complex interplay in its molecular mechanisms.

Biological Activity

Measured in a cell proliferation assay using NIH-3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 0.9543 μg/mL in the presence of 1.25 μg/mL Recombinant Human Klotho beta, corresponding to a specific activity is 1047.88 units/mg.

  • Measured in a cell proliferation assay using NIH-3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 0.9543μg/ml in the presence of 1.25 μg/mL Recombinant HumanKlotho  beta .corresponding to a specific activity is 1047.88units/mg.
Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

Q9JJN1 (A29-S210)

Gene ID
Molecular Construction
N-term
FGF-21 (A29-S210)
Accession # Q9JJN1
6*His
C-term
Synonyms
FGF21; Fibroblast Growth Factor 21; FGF-21
AA Sequence

AYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS

Molecular Weight

20-29 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 100 mM NaCl, pH 9.0 or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGF-21 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P72651
Quantity:
MCE Japan Authorized Agent: