FGF-5 Protein, Human (GST)

The FGF-5 protein critically regulates cell proliferation and differentiation, particularly during the hair growth cycle. It plays a key role in normal hair follicle progression, inhibiting hair elongation by promoting the anagen to catagen transition. FGF-5 Protein, Human (GST) is the recombinant human-derived FGF-5 protein, expressed by E. coli , with N-GST labeled tag.

FGF-5 protein assumes a crucial role in the intricate regulation of cell proliferation and differentiation, particularly in the context of the hair growth cycle. Its indispensability lies in orchestrating the normal progression of the hair follicle through different phases, functioning as a potent inhibitor of hair elongation. Specifically, FGF-5 promotes the transition from anagen, the growth phase, to catagen, the apoptosis-induced regression phase. This regulatory function is facilitated by its interactions with FGFR1 and FGFR2. Moreover, the affinity between fibroblast growth factors (FGFs) and their receptors is enhanced by the presence of heparan sulfate glycosaminoglycans, which serve as co-receptors in this intricate signaling pathway. The multifaceted actions of FGF-5 underscore its pivotal role in coordinating cellular processes critical for hair growth and maintenance, emphasizing its significance in the dynamic regulation of tissue development.

Human

E. coli

N-GST

P12034-1 (A18-G268)

2250  [NCBI]

AWAHGEKRLAPKGQPGPAATDRNPRGSSSRQSSSSAMSSSSASSSPAASLGSQGSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANMLSVLEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKKPPSPIKPKIPLSAPRKNTNSVKYRLKFRFG

54.6 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.