1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF Family
  4. Fibroblast Growth Factor
  5. FGF-5
  6. FGF-5 Protein, Human (GST)

The FGF-5 protein critically regulates cell proliferation and differentiation, particularly during the hair growth cycle. It plays a key role in normal hair follicle progression, inhibiting hair elongation by promoting the anagen to catagen transition. FGF-5 Protein, Human (GST) is the recombinant human-derived FGF-5 protein, expressed by E. coli , with N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The FGF-5 protein critically regulates cell proliferation and differentiation, particularly during the hair growth cycle. It plays a key role in normal hair follicle progression, inhibiting hair elongation by promoting the anagen to catagen transition. FGF-5 Protein, Human (GST) is the recombinant human-derived FGF-5 protein, expressed by E. coli , with N-GST labeled tag.

Background

FGF-5 protein assumes a crucial role in the intricate regulation of cell proliferation and differentiation, particularly in the context of the hair growth cycle. Its indispensability lies in orchestrating the normal progression of the hair follicle through different phases, functioning as a potent inhibitor of hair elongation. Specifically, FGF-5 promotes the transition from anagen, the growth phase, to catagen, the apoptosis-induced regression phase. This regulatory function is facilitated by its interactions with FGFR1 and FGFR2. Moreover, the affinity between fibroblast growth factors (FGFs) and their receptors is enhanced by the presence of heparan sulfate glycosaminoglycans, which serve as co-receptors in this intricate signaling pathway. The multifaceted actions of FGF-5 underscore its pivotal role in coordinating cellular processes critical for hair growth and maintenance, emphasizing its significance in the dynamic regulation of tissue development.

Species

Human

Source

E. coli

Tag

N-GST

Accession

P12034-1 (A18-G268)

Gene ID
Molecular Construction
N-term
GST
FGF-5 (A18-G268)
Accession # P12034-1
C-term
Synonyms
Fibroblast growth factor 5; Heparin-binding growth factor 5; HBGF-5; Smag-82; FGF5
AA Sequence

AWAHGEKRLAPKGQPGPAATDRNPRGSSSRQSSSSAMSSSSASSSPAASLGSQGSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANMLSVLEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKKPPSPIKPKIPLSAPRKNTNSVKYRLKFRFG

Molecular Weight

54.6 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

FGF-5 Protein, Human (GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGF-5 Protein, Human (GST)
Cat. No.:
HY-P700480
Quantity:
MCE Japan Authorized Agent: