FOLR1 Protein, Human (HEK293, His)

The FOLR1 protein is an important mediator of folate uptake, binding to folate and promoting the delivery of 5-methyltetrahydrofolate into cells. Studies show high affinity at neutral pH. FOLR1 Protein, Human (HEK293, His) is the recombinant human-derived FOLR1 protein, expressed by HEK293 , with C-His labeled tag.

The FOLR1 protein functions as a key mediator in folate uptake, binding to folate and reduced folic acid derivatives to facilitate the delivery of 5-methyltetrahydrofolate and folate analogs into the cell interior. This process is characterized by a high affinity for folate and folic acid analogs at neutral pH, as evidenced by various studies. Notably, exposure to a slightly acidic pH following receptor endocytosis induces a conformational change that significantly reduces its affinity for folates, facilitating their release. Beyond its role in folate transport, FOLR1 is essential for normal embryonic development and proper cell proliferation, underlining its significance in fundamental cellular processes.

Measured by its binding ability in a functional ELISA. Immobilized FOLR1 at 1 μg/mL can bind Anti-FOLR1 antibody, Mouse IgG1, the EC₅₀ of human FOLR1 protein is ≤9.719 ng/mL, corresponding to a specific activity is ≥1.029×10⁵ units/mg.

• 
  Measured by its binding ability in a functional ELISA. Immobilized FOLR1 at 1 μg/ml can bind Anti-FOLR1 antibody, Mouse IgG1, the EC₅₀ of human FOLR1 protein is 7.461 ng/mL, corresponding to a specific activity is 1.340×10⁵ units/mg.

Human

HEK293

C-His

P15328 (R25-S234)

2348  [NCBI]

RIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMS

34-38 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.