GFRAL Protein, Mouse (HEK293, His-Myc)

GFRAL protein, a brainstem-restricted receptor, regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stresses. It binds with GDF15, interacts with RET, and activates MAPK- and AKT- signaling pathways. GFRAL acts as a receptor for GDF15 and mediates cellular signaling through RET, requiring prior GDF15 binding. GFRAL Protein, Mouse (HEK293, His-Myc) is the recombinant mouse-derived GFRAL protein, expressed by HEK293 , with C-Myc, N-10*His labeled tag.

GFRAL protein is a brainstem-restricted receptor that plays a crucial role in regulating food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stresses. Upon binding with its ligand, GDF15, GFRAL interacts with RET and activates MAPK- and AKT- signaling pathways. GFRAL interacts with GDF15 and RET through its extracellular domain, acting as a receptor for GDF15 and mediating cellular signaling through the interaction with RET after GDF15 binding. It is important to note that the interaction with RET requires previous GDF15 binding.

Mouse

HEK293

C-Myc;N-10*His

Q6SJE0-1 (Q20-G349)

404194  [NCBI]

QTNDCAHLIQKCLIDANGCEQSWRSMEDTCLTPGDSCKINNSLHCNLSIQALVEKNFQFKECLCMDDLHCTVNKLFGKKCTNKTDNMEKDNKDKWNLTTTPFYHGFKQMQSCLEVTEACVGDVVCNAQLALYLKACSANGNLCDVKHCQAAIRFFYQNMPFNTAQMLAFCDCAQSDIPCQQSKETLHSKPCALNIVPPPTCLSVIHTCRNDELCRTHYRTFQTECWPHITGKCHEDETCISMLGKQDLTCSGSESCRAAFLGTFGTVLQVPCACRGVTQAEEHVCMIFQHMLHSKSCFNYPTPNVKDISSYEKKNSKEITLTGFNSFFNG

42.1 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.