GFRA3/GDNFR-alpha-3 Protein, Human (HEK293, His)

GFRA3/GDNFR-alpha-3 Protein, as the receptor for glial cell line-derived neurotrophic factor ARTN, is crucial for mediating RET receptor tyrosine kinase autophosphorylation and activation upon artemin stimulation. Its interaction with SORL1 suggests involvement in diverse cellular signaling pathways. GFRA3/GDNFR-alpha-3 Protein, Human (HEK293, His) is the recombinant human-derived GFRA3/GDNFR-alpha-3 protein, expressed by HEK293 , with C-His labeled tag. The total length of GFRA3/GDNFR-alpha-3 Protein, Human (HEK293, His) is 351 a.a., with molecular weight of ~50-57 kDa.

GFRA3/GDNFR-alpha-3 Protein functions as the receptor for the glial cell line-derived neurotrophic factor, ARTN (artemin). It plays a crucial role in mediating the autophosphorylation and activation of the RET receptor tyrosine kinase upon stimulation by artemin. Additionally, GFRA3/GDNFR-alpha-3 interacts with SORL1, indicating its involvement in various cellular signaling pathways.

Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human Artemin at 1 µg/mL can bind Human GFRA3 with an apparent KD is 1.463 nM.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human Artemin at 1 µg/mL can bind Human GFRA3 with an apparent KD is 1.463 nM.

Human

HEK293

C-6*His

O60609-1/NP_001487.2 (D32-W382)

2676  [NCBI]

DPLPTESRLMNSCLQARRKCQADPTCSAAYHHLDSCTSSISTPLPSEEPSVPADCLEAAQQLRNSSLIGCMCHRRMKNQVACLDIYWTVHRARSLGNYELDVSPYEDTVTSKPWKMNLSKLNMLKPDSDLCLKFAMLCTLNDKCDRLRKAYGEACSGPHCQRHVCLRQLLTFFEKAAEPHAQGLLLCPCAPNDRGCGERRRNTIAPNCALPPVAPNCLELRRLCFSDPLCRSRLVDFQTHCHPMDILGTCATEQSRCLRAYLGLIGTAMTPNFVSNVNTSVALSCTCRGSGNLQEECEMLEGFFSHNPCLTEAIAAKMRFHSQLFSQDWPHPTFAVMAHQNENPAVRPQPW

Approximately 50-57 kDa due to the glycosylation

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.5.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.