GIP Protein, Human (HEK293, hFc, solution)

The GIP protein is a member of the glucagon superfamily, an important incretin hormone that stimulates pancreatic beta cells to secrete insulin in response to food intake. Through its G protein-coupled receptor, it activates adenylyl cyclase and other signal transduction pathways. GIP Protein, Human (HEK293, hFc, solution) is the recombinant human-derived GIP protein, expressed by HEK293 , with C-hFc labeled tag. The total length of GIP Protein, Human (HEK293, hFc, solution) is 72 a.a., with molecular weight of ~38.77 kDa.

The GIP Protein, classified within the glucagon superfamily, serves as an incretin hormone crucial for glucose homeostasis. Its significance lies in being a potent stimulator of insulin secretion from pancreatic beta-cells in response to food ingestion and nutrient absorption. This stimulation occurs through the activation of its G protein-coupled receptor, triggering adenylyl cyclase and other signal transduction pathways. While GIP is a relatively poor inhibitor of gastric acid secretion, its primary role in insulin regulation positions it as a key player in metabolic processes. The gene exhibits biased expression, with noteworthy levels detected in the duodenum (RPKM 96.0) and small intestine (RPKM 33.9), emphasizing its involvement in digestive and metabolic functions within the gastrointestinal tract.

Human

HEK293

C-hFc

NP_004114.1 (E22-Q93)

2695  [NCBI]

EKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

Approximately 38.77 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.