1. Recombinant Proteins
  2. Cytokines and Growth Factors Immune Checkpoint Proteins CD Antigens
  3. TNF Superfamily Stimulatory Immune Checkpoint Molecules Macrophage CD Proteins Monocyte CD Proteins
  4. TNF Receptor Superfamily GITR/CD357
  5. GITR/CD357
  6. GITR Protein, Cynomolgus (HEK293, Fc)

GITR Protein, Cynomolgus (HEK293, Fc)

Cat. No.: HY-P78716
SDS COA Handling Instructions

GITR Protein, Cynomolgus (HEK293, Fc) is the recombinant Rhesus Macaque-derived GITR protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $40 In-stock
10 μg $67 In-stock
50 μg $188 In-stock
100 μg $320 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GITR Protein, Cynomolgus (HEK293, Fc) is the recombinant Rhesus Macaque-derived GITR protein, expressed by HEK293 , with C-hFc labeled tag.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Rhesus macaque GITR at 5 μg/mL (100 μL/well) can bind Biotinylated GITR Ligand. The ED50 for this effect is 0.9219 μg/mL, corresponding to a specific activity is 1.08×10^3 Unit/mg.

  • Measured by its binding ability in a functional ELISA. Immobilized Rhesus macaque GITR at 5 μg/mL (100 μL/well) can bind Biotinylated GITR Ligand. The ED50 for this effect is 0.9219 μg/mL, corresponding to a specific activity is 1.08×103 Unit/mg.
Species

Rhesus Macaque

Source

HEK293

Tag

C-hFc

Accession

XP_005545180.2 (Q20-E155)

Gene ID

102146362

Molecular Construction
N-term
GITR (Q20-E155)
Accession # XP_005545180.2
hFc
C-term
Synonyms
AITR; GITR; TNFRSF18; CD357
AA Sequence

QRPTGGPGCGPGRLLLGTGKDARCCRVHPTRCCRDYQSEECCSEWDCVCVQPEFHCGNPCCTTCQHHPCPSGQGVQPQGKFSFGFRCVDCALGTFSRGHDGHCKPWTDCTQFGFLTVFPGNKTHNAVCVPGSPPAE

Molecular Weight

Approximately 48 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from sterile 20 mM Tris-HCL, 150 mM NaCL, 100 mM arginine, 150 mM Glycine, pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

GITR Protein, Cynomolgus (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GITR Protein, Cynomolgus (HEK293, Fc)
Cat. No.:
HY-P78716
Quantity:
MCE Japan Authorized Agent: