1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens Receptor Proteins
  3. CSF & Receptors Macrophage CD Proteins Monocyte CD Proteins Endothelial cell CD Proteins Cytokine Receptors
  4. GM-CSFR GM-CSF R alpha/CD116
  5. GM-CSF R alpha/CD116
  6. GM-CSF R alpha Protein, Human (HEK293, Fc)

GM-CSF R alpha Protein, Human (HEK293, Fc)

Cat. No.: HY-P73083
Handling Instructions Technical Support

GM-CSF R alpha is the alpha subunit of the heterodimeric receptor for colony stimulating factor 2. GM-CSF R alpha binds to the cytokine with high specificity and low affinity. GM-CSF R alpha binds to GM-CSF and induces cell differentiation. GM-CSF R alpha monoclonal antibody decreases GM-CSFRα expression on GM-CSF-responsive cells and shows anti-inflammatory activity in rheumatoid arthritis (RA). GM-CSF R alpha Protein, Human (HEK293, Fc) is a recombinant protein with a C-Terminal Fc label, It consists of 320 amino acids (M1-G320) and is produced in HEK293 cells.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

GM-CSF R alpha is the alpha subunit of the heterodimeric receptor for colony stimulating factor 2. GM-CSF R alpha binds to the cytokine with high specificity and low affinity[1]. GM-CSF R alpha binds to GM-CSF and induces cell differentiation[2]. GM-CSF R alpha monoclonal antibody decreases GM-CSFRα expression on GM-CSF-responsive cells and shows anti-inflammatory activity in rheumatoid arthritis (RA)[3]. GM-CSF R alpha Protein, Human (HEK293, Fc) is a recombinant protein with a C-Terminal Fc label, It consists of 320 amino acids (M1-G320) and is produced in HEK293 cells.

Background

GM-CSF R alpha is expressed on myeloid cells and on some non-hemopoietic cells, such as endothelial cells, not on T cells[2].
The amino acid sequence of human GM-CSF R alpha protein has low homology for mouse GM-CSF R alpha protein.
GM-CSF receptor (GM-CSFR) consists of two subunits, an α-subunit, which binds the cytokine with low affinity, and a larger β-subunit (beta common; βc), responsible for signaling, forming a ternary receptor complex. Signal transduction in response to the cytokines interleukin (IL)-3 and IL-5 is also mediated by βc; therefore, receptor specificity is due to GM-CSFRα[1]. After binding GM-CSF to its receptor, Janus-kinase-2 (JAK-2) is recruited to the cytoplasmic domain of the β chain, and activation of JAK-2 occurs, which subsequently induces STAT-5 phosphorylation. This signaling pathway induces migration of STAT-5 dimers to the nucleus and promotes the transcription of various genes such as pim-1 and CIS to induce cell differentiation[2].
GM-CSFR α-subunit significantly increases positive synovial macrophages in the RA synovium. GM-CSFR α monoclonal antibody suppresses disease activity in the murine collagen-induced arthritis model[3].

Biological Activity

Measured by its ability to inhibit GM-CSF dependent proliferation of TF-1 human erythroleukemic cells. The ED50 for this effect is typically <15 μg/mL.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

P15509 (E23-G320)

Gene ID
Molecular Construction
N-term
GM-CSF R alpha (E23-G320)
Accession # P15509
hFc
C-term
Synonyms
Granulocyte-macrophage colony-stimulating factor receptor subunit alpha; GMR-alpha; CD116; CSF2RA; CSF2R; CSF2RY
AA Sequence

EKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDG

Molecular Weight

Approximately 90 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

GM-CSF R alpha Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GM-CSF R alpha Protein, Human (HEK293, Fc)
Cat. No.:
HY-P73083
Quantity:
MCE Japan Authorized Agent: