HAI-2 Protein, Human (HEK293, His)

HAI-2 protein is a multifunctional inhibitor that regulates multiple cellular processes by potently inhibiting HGFAC and reducing serine protease activity, specifically TMPRSS13 and ST14/matriptase. HAI-2 is good at inhibiting plasmin, plasma and tissue kallikrein, with broad-spectrum inhibitory capabilities. HAI-2 Protein, Human (HEK293, His) is the recombinant human-derived HAI-2 protein, expressed by HEK293 , with C-6*His labeled tag.

HAI-2, a versatile protein with a multifaceted inhibitory role, emerges as a potent regulator in diverse cellular processes. Its inhibitory prowess extends to HGFAC, acting as a robust sentinel against its activities. Beyond this, HAI-2 demonstrates proficiency in inhibiting plasmin, as well as plasma and tissue kallikrein, highlighting its broad-spectrum inhibitory capabilities. Notably, HAI-2 is a key modulator of serine protease activities, curtailing the functions of TMPRSS13 and ST14/matriptase in vitro. The intricate dance of molecular interactions includes a direct engagement with TMPRSS13, orchestrating an interplay that not only inhibits but also facilitates the phosphorylation and cellular localization of this serine protease. In essence, HAI-2 emerges as a versatile guardian, intricately navigating the cellular landscape to fine-tune serine protease activities and maintain a delicate balance in various physiological contexts.

Human

HEK293

C-6*His

O43291-1 (A28-K197)

10653  [NCBI]

ADRERSIHDFCLVSKVVGRCRASMPRWWYNVTDGSCQLFVYGGCDGNSNNYLTKEECLKKCATVTENATGDLATSRNAADSSVPSAPRRQDSEDHSSDMFNYEEYCTANAVTGPCRASFPRWYFDVERNSCNNFIYGGCRGNKNSYRSEEACMLRCFRQQENPPLPLGSK

24-30 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.