HB-EGF Protein, Human (CHO)

HB-EGF Protein, Human (CHO) is shown to play a role in wound healing, cardiac hypertrophy, and heart development and function.

Heparin-binding epidermal growth factor-like growth factor (HBEGF) is a heparin-binding member of the EGF family. It is a potent mitogen and chemotactic factor for fibroblasts and smooth muscle cells. As with other EGF family members, HB-EGF binds and activates EGF receptors 1 and 4. HB-EGF has been shown to stimulate the growth of a variety of cells in an autocrine or paracrine manner and to be involved in stromal proliferation. HB-EGF is also a potent inducer of tumor growth and angiogenesis^[1].

The ED₅₀ is <0.5 ng/mL as measured by 3T3 cells.

Human

CHO

Tag Free

Q99075 (D63-L148)

1839  [NCBI]

DLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSL

Approximately 12-15 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against PBS.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Ongusaha PP, et al. HB-EGF is a potent inducer of tumor growth and angiogenesis. Cancer Res. 2004 Aug 1;64(15):5283-90.  [Content Brief]