1. Recombinant Proteins
  2. Others
  3. HCFC2 Protein, Mouse (His)

HCFC2 protein is critically involved in cellular processes by binding to KMT2A/MLL1 and participating in the MLL1/MLL complex. This complex, characterized by KMT2A/MLL1, ASH2L, RBBP5, DPY30, WDR5, MEN1, HCFC1, and HCFC2, plays a key role in epigenetic regulation and gene expression. HCFC2 Protein, Mouse (His) is the recombinant mouse-derived HCFC2 protein, expressed by E. coli , with N-6*His labeled tag. The total length of HCFC2 Protein, Mouse (His) is 486 a.a., with molecular weight of ~55.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

HCFC2 protein is critically involved in cellular processes by binding to KMT2A/MLL1 and participating in the MLL1/MLL complex. This complex, characterized by KMT2A/MLL1, ASH2L, RBBP5, DPY30, WDR5, MEN1, HCFC1, and HCFC2, plays a key role in epigenetic regulation and gene expression. HCFC2 Protein, Mouse (His) is the recombinant mouse-derived HCFC2 protein, expressed by E. coli , with N-6*His labeled tag. The total length of HCFC2 Protein, Mouse (His) is 486 a.a., with molecular weight of ~55.0 kDa.

Background

The HCFC2 Protein plays a critical role in cellular processes by binding to KMT2A/MLL1 and functioning as a component of the MLL1/MLL complex. This complex, composed of KMT2A/MLL1, ASH2L, RBBP5, DPY30, WDR5, MEN1, HCFC1, and HCFC2, is involved in epigenetic regulation and gene expression. Additionally, HCFC2 interacts with TASOR, indicating its association with molecular complexes that contribute to various cellular functions. These interactions underscore the significance of HCFC2 in the intricate machinery of epigenetic regulation and chromatin modification.

Species

Mouse

Source

E. coli

Tag

N-6*His

Accession

G5E837 (M1-E486)

Gene ID

67933  [NCBI]

Molecular Construction
N-term
6*His
HCFC2 (M1-E486)
Accession # G5E837
C-term
Synonyms
Host cell factor 2 ; HCF-2; C2 factor; Hcfc2
AA Sequence

MAAPSLLNWRRVSSFTGPVPRARHGHRAVAIRELMIIFGGGNEGIADELHVYNTVTNQWFLPAVRGDIPPGCAAHGFVCDGTRILVFGGMVEYGRYSNELYELQASRWLWKKVKPQPPPSGFPPCPRLGHSFSLYGNKCYLFGGLANESEDSNNNVPRYLNDFYELELQHGSGVVGWSIPATKGVVPSPRESHTAIIYCKKDSASPKMYVFGGMCGARLDDLWQLDLETMSWSKPETKGTVPLPRSLHTASVIGNKMYIFGGWVPHKGENPETSPHDCEWRCTSSFSYLNLDTAEWTTLVSDSQEDKKNSRPRPRAGHCAVAIGTRLYFWSGRDGYKKALNSQVCCKDLWYLDTEKPPAPSQVQLIKATTNSFHVKWDEVPTVEGYLLQLNTDLTYQATSSDSSAAPSVLGGRMDPHRQGSNSTLHNSVSDTVNSTKTEHTAVRGTSLRSKPDSRAVDSSAALHSPLAPNTSNNSSWVTDMLRKNE

Molecular Weight

Approximately 55.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

HCFC2 Protein, Mouse (His) Related Classifications

Help & FAQs
  • How should lyophilized recombinant proteins be reconstituted and stored?

    1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss. 2. Taking 10 μg as an example, first add 20 μL of reconstituted solution provided by MCE and use a pipette to gently resuspend the lyophilized protein until it is fully dissolved.. (For most proteins, the reconstitution solution we provide is sterile water. If a diluent other than water is required, it will be indicated in the product's Certificate of Analysis (COA).). 3. Add an additional 80 μL of buffer/culture medium containing carrier protein (either 0.1% BSA, 5% HSA, 10% FBS, or 5% trehalose), and then use a pipette to gently mix until uniform. The final concentration is should not be lower than 100 μg/mL. 4. Aliquot at least 20 μL per tube. 5. After aliquoting, store it frozen at a temperature ranging from -20ºC to -80ºC, and it can be preserved for 3 to 6 months.

  • How should solution-form recombinant proteins be stored?

    1. The product can be stored in its original form and diluted as needed upon use. 2. Alternatively, dilute with a buffer/culture medium containing a carrier protein (either 0.1% BSA, 5% HSA, 10% FBS, or 5% alginate), mix well by pipetting, and ensure that

  • Why is it necessary to add carrier proteins?

    Carrier proteins are commonly added to enhance the stability of recombinant proteins, preventing them from adhering to the walls of the container during freezing or thawing processes. Plastic tubes have a certain adsorptive capacity for proteins, which may lead to difficulty in separating the protein from the tube walls, resulting in a decrease in the actual concentration of the protein in the solution and thus affecting its activity. To minimize such losses, it is recommended to add a commonly used carrier protein solution prior to the long-term storage of recombinant protein products.

  • Carrier protein types and options?

    In cases where the carrier protein is not expected to influence the experimental outcomes, an appropriate carrier protein, such as 0.1% BSA (Bovine Serum Albumin), 5% HSA (Human Serum Albumin), 10% FBS (Fetal Bovine Serum), or 5% trehalose, can be incorpo

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HCFC2 Protein, Mouse (His)
Cat. No.:
HY-P70906
Quantity:
MCE Japan Authorized Agent: