1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Stimulatory Immune Checkpoint Molecules T Cell CD Proteins
  4. ICOS/CD278 ICOS/CD278
  5. ICOS Protein, Mouse (HEK293, His)

ICOS Protein, Mouse (HEK293, His)

Cat. No.: HY-P72619
Data Sheet SDS COA Handling Instructions

ICOS proteins optimize T cell responses to foreign antigens, promoting proliferation, lymphokine secretion, upregulation of cell-cell interaction molecules, and efficient B cell antibody secretion. ICOS is essential for efficient communication of T cells and B cells and for normal antibody responses to T cell-dependent antigens. ICOS Protein, Mouse (HEK293, His) is the recombinant mouse-derived ICOS protein, expressed by HEK293 , with C-6*His labeled tag. The total length of ICOS Protein, Mouse (HEK293, His) is 122 a.a., with molecular weight of 16-30 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg USD 48 In-stock
50 μg USD 144 In-stock
100 μg   Get quote  

Get it December 23 by noon. Order within 9 hrs 24 mins.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ICOS proteins optimize T cell responses to foreign antigens, promoting proliferation, lymphokine secretion, upregulation of cell-cell interaction molecules, and efficient B cell antibody secretion. ICOS is essential for efficient communication of T cells and B cells and for normal antibody responses to T cell-dependent antigens. ICOS Protein, Mouse (HEK293, His) is the recombinant mouse-derived ICOS protein, expressed by HEK293 , with C-6*His labeled tag. The total length of ICOS Protein, Mouse (HEK293, His) is 122 a.a., with molecular weight of 16-30 kDa.

Background

The ICOS protein enhances all fundamental T-cell responses to foreign antigens, including proliferation, secretion of lymphokines, up-regulation of cell-cell interaction molecules, and providing effective help for antibody secretion by B-cells. It is essential for facilitating efficient communication between T and B-cells and for normal antibody responses to T-cell dependent antigens. Although it does not increase the production of interleukin-2, it superinduces the synthesis of interleukin-10. Additionally, it prevents apoptosis of pre-activated T-cells and plays a critical role in CD40-mediated class switching of immunoglobulin isotypes. ICOS exists as a homodimer, connected by disulfide bonds.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

Q9WVS0 (E21-L142)

Gene ID
Molecular Construction
N-term
ICOS (E21-L142)
Accession # Q9WVS0
6*His
C-term
Synonyms
Inducible T-cell costimulator; CD278; AILIM; CVID1; ICOS
AA Sequence

EINGSADHRMFSFHNGGVQISCKYPETVQQLKMRLFREREVLCELTKTKGSGNAVSIKNPMLCLYHLSNNSVSFFLNNPDSSQGSYYFCSLSIFDPPPFQERNLSGGYLHIYESQLCCQLKL

Molecular Weight

16-30 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ICOS Protein, Mouse (HEK293, His) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ICOS Protein, Mouse (HEK293, His)
Cat. No.:
HY-P72619
Quantity:
MCE Japan Authorized Agent: