1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interferon & Receptors
  4. IFN-alpha
  5. IFN-alpha 6
  6. IFN-alpha 6/IFNA6 Protein, Human (His-Myc)

IFN-alpha 6/IFNA6 Protein, Human (His-Myc)

Cat. No.: HY-P72244
Data Sheet Handling Instructions Technical Support

IFN-alpha 6 (IFNA6), belongs to type I interferon family, is produced by macrophages with antiviral activities. IFN-alpha 6/IFNA6 Protein, Human (His-Myc) contains 169 a.a. (S21-E189), produced in E. coli cells with a N-terminal His-tag and a C-terminal Myc-tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IFN-alpha 6 (IFNA6), belongs to type I interferon family, is produced by macrophages with antiviral activities[1]. IFN-alpha 6/IFNA6 Protein, Human (His-Myc) contains 169 a.a. (S21-E189), produced in E. coli cells with a N-terminal His-tag and a C-terminal Myc-tag.

Background

IFN-alpha 6 (IFNA6; IFN-α6), belongs to the alpha/beta interferon (IFN) family, is produced by the macrophages with antiviral activities[1]. Interferon (IFN) is originally identified as a substance ‘interfering’ with viral replication in vitro. IFN-α/β and related molecules are classified as type I IFNs, as for the other two types of type II IFN (IFN-γ) and type III IFNs (IFN-λ), respectively[2].
Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. Interferon alpha (IFNa) shows significant biological activity in various cancers, paticularly haematological malignancies such as hairy cell leukaemia and chronic myelogenous leukaemia[3].
Type I interferons (IFNs) are produced early in response to viral infection and modulate adaptive immunity. IFN-alpha 6 involves in acute myocarditis and chronic cardiac inflammation inhibition, promotes systemic murine cytomegalovirus (MCMV) infection by reducing MCMV replication[4].
As for a wildly use of IFN in animal model, the sequence of amino acids in IFNA6 protein of human is very different from mouse (56.61%)

In Vivo

Humanized IFN-alpha 6 (IFNA6) shows protection on systemic murine cytomegalovirus (MCMV) infection and myocarditis by DNA-inoculated manner, and reduces MCMV replication[4].

Species

Human

Source

E. coli

Tag

N-10*His;C-Myc

Accession

P05013 (S21-E189)

Gene ID
Molecular Construction
N-term
10*His
IFNA6 (S21-E189)
Accession # P05013
C-term
Synonyms
IFNA6Interferon alpha-6; IFN-alpha-6; Interferon alpha-54; Interferon alpha-K; LeIF K
AA Sequence

SLDCDLPQTHSLGHRRTMMLLAQMRRISLFSCLKDRHDFRFPQEEFDGNQFQKAEAISVLHEVIQQTFNLFSTKDSSVAWDERLLDKLYTELYQQLNDLEACVMQEVWVGGTPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSSSRNLQERLRRKE

Molecular Weight

Approximately 25.1 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References

IFN-alpha 6/IFNA6 Protein, Human (His-Myc) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IFN-alpha 6/IFNA6 Protein, Human (His-Myc)
Cat. No.:
HY-P72244
Quantity:
MCE Japan Authorized Agent: