IFN-lambda 2/IL-28A Protein, Mouse (HEK293, His, solution)

IFN-lambda 2/IL-28A Protein, Mouse (HEK 293, His), a type III interferon, is a member of IL-10-interferon family. IFN-lambda 2/IL-28A Protein shows anti-viral, anti-tumor and immune stimulatory properties.

Interferon lambdas (IFN-λs; IFNL1-4) modulate immunity in the context of infections and autoimmune diseases, through a network of induced genes. IL-28A, IL-28B and IL-29 (also designated type III interferons) constitute a new subfamily within the IL-10-interferon family. IL-28A, IL-28B and IL-29 share a common cellular receptor consisting of the cytokine receptor family class II members IL-28R1 (also designated IFN-λR1, LICR2 and CRF2/12) and IL-10R2. IL-28A was shown to reduce viral replication or the cytopathic effect of a range of viruses, including the DNA viruses murine CMV, hepatitis B virus and herpes simplex virus 2, the ss (+) RNA viruses EMCV, west nile virus and hepatitis C virus, as well as the ss (-) RNA viruses vesicular stomatitis virus, influenza-A virus and Hantaan virus^[1][2].

Mouse

HEK293

N-6*His

Q4VK74 (D20-193V)

330496  [NCBI]

DPVPRATRLPVEAKDCHIAQFKSLSPKELQAFKKAKDAIEKRLLEKDLRCSSHLFPRAWDLKQLQVQERPKALQAEVALTLKVWENMTDSALATILGQPLHTLSHIHSQLQTCTQLQATAEPRSPSRRLSRWLHRLQEAQSKETPGCLEASVTSNLFRLLTRDLKCVANGDQCV

Approximately 21.8 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. Syedbasha M, et, al. Interferon Lambda: Modulating Immunity in Infectious Diseases. Front Immunol. 2017 Feb 28;8:119.  [Content Brief]

  [2]. Witte K, et, al. IL-28A, IL-28B, and IL-29: promising cytokines with type I interferon-like properties. Cytokine Growth Factor Rev. 2010 Aug;21(4):237-51.  [Content Brief]