IFN-lambda 3/IL-28B Protein, Human (HEK293, His)

IFN-lambda 3 (IL-28B) is a member of the Type-III interferon family. IFN-lambda 3 has high similar 96% sequence identity with IFN-lambda 2 at the amino acid level. IFN-lambda 2 has antiviral antitumour and immunomodulatory activities^[1]. IFN-lambda 2 signals through a heterodimeric receptor complex comprising IFNLR1 and IL-10RB. When binding to the receptor complex, Jak1 and Tyk2 will be activated, and leads to tyrosine phosphorylation of the IFN-λR1 and activation of STAT1 and STAT2. Activated STAT1 and STAT2 together with IRF-9 form a trimeric transcription factor complex (ISGF3). The formed ISGF3 then translocate to the nucleus and promotes the production of IFN-stimulated genes (ISGs)^[2]. IFN-lambda 3/IL-28B Protein, Human (HEK293, His) is a recombinant human IFN-lambda 3 (V22-V196) with C-terminal 6*His tag, which is expressed in HEK293.

IFN-lambda 3 (IL-28B) is a member of the Type-III interferon family. Human IFN-lambda 2 shares 61.98% common aa identity with mouse. IFN-lambda 2 is produced particularly by dendritic cells (DCs), when following viral or bacterial infection^[3].
IFN-lambda 3 mediates effects by a heterodimeric receptor complex comprising IFNλ receptor 1 (IFNLR1) and IL-10 receptor subunit-β (IL-10RB). When binding to the receptor complex, Jak1 and Tyk2 will be activated, and leads to subsequent tyrosine phosphorylation of the IFN-λR1 (intracellular domain, Tyr406 and Tyr343, Tyr517), and activation of STAT1 and STAT2. Activated STAT1 and STAT2 together with IRF-9 (p48) form a trimeric transcription factor complex (ISGF3). The formed ISGF3 complexes then translocate to the nucleus and promotes the production of IFN-stimulated genes (ISGs) such as IRF7, MX1, and OAS1^[2].
IFN-lambda 3 has antiviral antitumour and immunomodulatory activities^[1]. Genetic variants in the IFN-lambda 3 g is associated with pulmonary fibrosis in patients with systemic sclerosis^[4].

IFN-lambda 3 (human, 100 ng/mL, 2 h) inhibits Influenza H1N1-induced Th2 response and B cell activation in PBMCs from transplant recipients^[5].
IFN-lambda 3 (human, 0.15 μg/mL) inhibits HCV propagation in Huh7.5.1 cells^[6].

Human

HEK293

C-6*His

Q8IZI9 (V22-V196)

282617  [NCBI]

VPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV

Approximately 22 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB,150 mM NaCl,1 mM EDTA, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Lopušná K, et al. Interferons lambda, new cytokines with antiviral activity. Acta Virol. 2013;57(2):171-9.  [Content Brief]

  [2]. Donnelly RP, et al. Interferon-lambda: a new addition to an old family. J Interferon Cytokine Res. 2010 Aug;30(8):555-64.  [Content Brief]

  [3]. Witte K, et al. IL-28A, IL-28B, and IL-29: promising cytokines with type I interferon-like properties. Cytokine Growth Factor Rev. 2010 Aug;21(4):237-51.  [Content Brief]

  [4]. Metwally M, et al. IFNL3 genotype is associated with pulmonary fibrosis in patients with systemic sclerosis. Sci Rep. 2019 Oct 16;9(1):14834.  [Content Brief]

  [5]. Egli A, et al. IL-28B is a key regulator of B- and T-cell vaccine responses against influenza. PLoS Pathog. 2014 Dec 11;10(12):e1004556.  [Content Brief]

  [6]. Cheng M, et al. Recombinant human interleukin 28B: anti-HCV potency, receptor usage and restricted cell-type responsiveness. J Antimicrob Chemother. 2012 May;67(5):1080-7.  [Content Brief]