IGF-I/IGF-1 Protein, Rat

IGF-I/IGF-1 Protein, Rat has somatomedin activity and ability to potently promote neuronal survival.

IGF-I (Insulin-like Growth Factor-I) has somatomedin activity. IGF-I stimulates the growth of hypophysectiomized rats in a dose-dependent manner^[1]. Circulating IGF-I plays a prominent role in normal growth and development by mediating the indirect effects of growth hormone, with which it has a complex relationship. Delivery of IGF-I to the CNS may be beneficial in the treatment of Alzheimer’s disease or stroke because of IGF-I’s ability to potently promote neuronal survival, rescue hippocampal neurons from β-amyloid induced neurotoxicity, reduce tau phosphorylation, protect cortical neurons against nitric oxide-mediated neurotoxicity, rescue neurons from glucose deprivation and stimulate neurogenesis and synaptogenesis^[2].

1.The ED₅₀ is <10 ng/mL as measured by FDCP-1 cells, corresponding to a specific activity of >1.0 × 10⁵ units/mg.
2.Measured in a serum-free cell proliferation assay using MCF-7 human breast cancer cells. The ED₅₀ for this effect is 9.473 ng/mL. corresponding to a specific activity is 1.05×10⁵ units/mg.

• 
  Measured in a serum-free cell proliferation assay using MCF-7 human breast cancer cells. The ED₅₀ for this effect is 9.473 ng/mL. corresponding to a specific activity is 1.05×10⁵ units/mg.

Rat

E. coli

Tag Free

P08025 (G49-A118)

24482  [NCBI]

GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSA

Approximately 9 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against PBS or PBS, pH 7.4, 8% trehalose.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Schoenle E, et al. Insulin-like growth factor I stimulates growth in hypophysectomized rats. Nature. 1982 Mar 18;296(5854):252-3.  [Content Brief]

  [2]. Thorne RG, et al. Delivery of insulin-like growth factor-I to the rat brain and spinal cord along olfactory and trigeminal pathways following intranasal administration. Neuroscience. 2004;127(2):481-96.  [Content Brief]