IGFBP-6 Protein, Human (HEK293, His)

IGFBP-6 protein is an important IGFBP member that regulates insulin-like growth factor (IGF) by changing its interaction with cell surface receptors, thereby affecting IGF-induced growth responses. In addition to regulating IGF signaling, IGFBP-6 also activates the MAPK pathway and induces cell migration. IGFBP-6 Protein, Human (HEK293, His) is the recombinant human-derived IGFBP-6 protein, expressed by HEK293 , with C-His labeled tag.

IGFBP-6 Protein, a member of the insulin-like growth factor-binding proteins (IGFBPs), assumes a pivotal role in regulating the half-life of insulin-like growth factors (IGFs) and modulating their effects on cell culture, exhibiting the ability to either inhibit or stimulate IGF-induced growth-promoting responses. This regulatory function is achieved through the alteration of IGFs' interaction with their respective cell surface receptors. Beyond its role in modulating IGF signaling, IGFBP-6 also exhibits additional cellular effects, such as the activation of the MAPK signaling pathway and the induction of cell migration. Notably, IGFBP-6 interacts with PHB2 via its C-terminal domain, highlighting its involvement in protein-protein interactions that may contribute to diverse cellular processes. The multifaceted actions of IGFBP-6 underscore its significance in orchestrating intricate cellular responses associated with growth, migration, and signaling pathways.

1. Measured by its ability to bind human IGF1 in functional ELISA.
2. Measured by its ability to bind human IGF2 in functional ELISA.
3. Measured by its ability to inhibit the biological activity of IGFII on MCF7 human breast adenocarcinoma cells (Karey, K.P. et al. (1988) Cancer Research 48:4083.). The ED₅₀ for this effect is typically 1-5 μg/mL in the presence of 14 ng/mL human IGFII.

Human

HEK293

C-His

P24592 (R28-G240)

3489  [NCBI]

MTPHRLLPPLLLLLALLLAASPGGALARCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEAEGCLRREGQECGVYTPNCAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKESKPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTGSSG

Approximately 36 kDa

Greater than 95% as determined by reducing SDS-PAGE

Solution.

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.