IL-10 Protein, Mouse

IL-10 protein is a key immunomodulator that, by binding to its heterotetrameric receptors (IL10RA and IL10RB), activates JAK1 and STAT2 (the latter phosphorylates STAT3), thereby triggering potent anti-inflammatory effects. Phosphorylated STAT3 translocates to the nucleus and promotes the expression of anti-inflammatory mediators. IL-10 Protein, Mouse is the recombinant mouse-derived IL-10 protein, expressed by E. coli , with tag free. The total length of IL-10 Protein, Mouse is 160 a.a..

IL-10, a major immune regulatory cytokine, exerts profound anti-inflammatory functions, mitigating excessive tissue disruption caused by inflammation. Upon binding to its heterotetrameric receptor, comprising IL10RA and IL10RB, IL-10 initiates a signaling cascade involving JAK1 and STAT2-mediated phosphorylation of STAT3. Subsequently, phosphorylated STAT3 translocates to the nucleus, where it drives the expression of anti-inflammatory mediators. IL-10 specifically targets antigen-presenting cells (APCs), such as macrophages and monocytes, inhibiting their release of pro-inflammatory cytokines, including GM-CSF, G-CSF, IL-1 alpha, IL-1 beta, IL-6, IL-8, and TNF-alpha. Additionally, IL-10 interferes with antigen presentation by reducing the expression of MHC-class II and co-stimulatory molecules, thereby dampening their ability to induce T cell activation. Furthermore, IL-10 controls the inflammatory response of macrophages by reprogramming essential metabolic pathways, including mTOR signaling. IL-10 exists as a homodimer and interacts with IL10RA and IL10RB.

Measured in a cell proliferation assay using FDC-P1 Mouse bone marrow cells. The ED₅₀ for this effect is ＜6 ng/mL.

Mouse

E. coli

Tag Free

P18893 (S19-S178)

16153  [NCBI]

SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS

Approximately 15-17 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 4 mM HCl or PBS, pH 7.4, 8% trehalose.

<0.01 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.