IL-10 Protein, Human

IL-10 Protein, Human is an anti-inflammatory, immunomodulatory cytokine that regulates mucosal inflammation.

Interleukin 10 (IL-10) is an anti-inflammatory, immunomodulatory cytokine that regulates mucosal inflammation. A promising alternative is interleukin 10 (IL-10), a cytokine with multiple anti-inflammatory and immunoregulatory activities, including inhibition of T-cell/macrophage activation and proinflammatory cytokine synthesis^[1]. IL-10, a cytokine possessing strong anti-inflammatory properties, is under investigation for its therapeutic use as an immunosuppressant. The immunosuppressive actions of IL-10 and corticosteroids include inhibition of proinflammatory cytokine production by monocytes and polymorphonuclear leukocytes (IFN-γ, TNF-α, IL-1β, IL-6, GM-CSF) both at the protein and messenger RNA levels and prevention of mitogen-induced T-cell proliferation^[2].

1.The ED₅₀ is typically 1- 8 ng/mL as measured by MC/9-2 mouse mast cells in a cell proliferation assay.
2.Immobilized human IL10 at 2 μg/mL (100 μL/well) can bind Cynomolgus IL10RA-Fc and the EC₅₀ of Cynomolgus IL10RA-Fc is ≤1 μg/mL.

Human

E. coli

Tag Free

P22301/NP_000563.1 (S19-N178)

3586  [NCBI]

SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN

Approximately 18.6 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against 20mM Tris, 20mM NaCl, pH 6.5. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Fedorak RN, et al. Recombinant human interleukin 10 in the treatment of patients with mild to moderately active Crohn's disease. The Interleukin 10 Inflammatory Bowel Disease Cooperative Study Group. Gastroenterology. 2000 Dec;119(6):1473-82.  [Content Brief]

  [2]. Chakraborty A, et al. Pharmacodynamic interaction of recombinant human interleukin-10 and prednisolone using in vitro whole blood lymphocyte proliferation. J Pharm Sci. 2002 May;91(5):1334-42.  [Content Brief]