IL-11 Protein, Cynomolgus

IL-11 protein is a potent cytokine that significantly stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells, leading to megakaryocyte maturation and platelet production. It also promotes hepatocyte proliferation in response to liver injury. IL-11 Protein, Cynomolgus is the recombinant cynomolgus-derived IL-11 protein, expressed by E. coli , with tag free. The total length of IL-11 Protein, Cynomolgus is 178 a.a., with molecular weight of ~20 KDa.

IL-11 Protein is a potent cytokine that plays a crucial role in stimulating the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells, leading to the maturation of megakaryocytes and subsequent production of platelets. Additionally, IL-11 Protein facilitates the proliferation of hepatocytes in response to liver damage. Upon binding to its receptor, composed of IL6ST and IL11RA, IL-11 Protein triggers a signaling cascade that promotes cell proliferation. This signaling cascade involves the activation of intracellular protein kinases and the phosphorylation of STAT3. IL-11 Protein can engage in two types of signaling: 'classic signaling' occurs through the interaction with membrane-bound IL11RA and IL6ST, while 'trans-signaling' is induced by the binding of IL-11 and soluble IL11RA to IL6ST. Furthermore, IL-11 Protein interacts with IL11RA to form a multimeric signaling complex in association with IL6ST.

Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED₅₀ for this effect is 4.216 ng/mL, corresponding to a specific activity is 2.371×10⁵ units/mg.

• 
  Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED₅₀ for this effect is 4.216 ng/mL，corresponding to a specific activity is 2.371×10⁵ units/mg.

Cynomolgus

E. coli

Tag Free

XP_005595839.2/P20808 (P22-L199)

102128313

PGPPPGSPRASPDPRAELDSTVLLTRSLLEDTRQLTIQLKDKFPADGDHNLDSLPTLAMSAGALGALQLPSVLTRLRADLLSYLRHVQWLRRAMGSSLKTLEPELGTLQTRLDRLLRRLQLLMSRLALPQLPPDPPAPPLAPPSSTWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Approximately 20 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.