IL-11 Protein, Human (P.pastoris)

IL-11 protein is a cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells, leading to increased platelet production. IL-11 Protein, Human (P.pastoris) is the recombinant human-derived IL-11 protein, expressed by P. pastoris , with tag free.

IL-11 Protein emerges as a multifaceted cytokine, orchestrating crucial biological processes. It stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells, culminating in the maturation of megakaryocytes and augmented platelet production. Additionally, IL-11 plays a pivotal role in liver regeneration by promoting hepatocyte proliferation in response to damage. Its binding to a receptor complex, composed of IL6ST and IL11RA, initiates a signaling cascade that fuels cellular proliferation. This interaction activates intracellular protein kinases and triggers the phosphorylation of STAT3. Notably, IL-11 exhibits versatility in signaling modalities: it engages in 'classic signaling' upon interaction with membrane-bound IL11RA and IL6ST, and alternatively, it participates in 'trans-signaling' when binding to IL6ST in conjunction with soluble IL11RA. The intricate interplay of IL-11 and its receptors, IL11RA and IL6ST, forms a multimeric signaling complex with far-reaching implications for diverse physiological responses.

Measured in a cell proliferation assay using TF-1 cells. The ED₅₀ for this effect is 3.505 ng/mL, corresponding to a specific activity is 2.853×10^5 U/mg.

Human

P. pastoris

Tag Free

P20809-1 (G23-L199)

3589  [NCBI]

GPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Approximately 19.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 2% Glycine, pH 7.2.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.