IL-11 Protein, Mouse (HEK293, Fc)

IL-11 protein is a multifunctional cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation to increase platelet production. It also contributes to liver cell proliferation in response to liver injury. IL-11 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived IL-11 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of IL-11 Protein, Mouse (HEK293, Fc) is 178 a.a., with molecular weight of 50-60 kDa.

The IL-11 Protein emerges as a versatile cytokine with multifaceted roles, stimulating the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells while inducing megakaryocyte maturation, leading to heightened platelet production. Additionally, IL-11 contributes to hepatocyte proliferation in response to liver damage. Upon binding to its receptor, formed by IL6ST and either IL11RA1 or IL11RA2, IL-11 activates a signaling cascade promoting cell proliferation, a process implicated in various cancers. This signaling triggers the activation of intracellular protein kinases and the phosphorylation of STAT3. Notably, the interaction with membrane-bound IL11RA and IL6ST leads to 'classic signaling,' while the binding of soluble IL11RA to IL6ST stimulates 'trans-signaling.' IL-11 further forms a multimeric signaling complex by interacting with either IL11RA1 or IL11RA2, highlighting its pivotal role in orchestrating diverse cellular responses.

Mouse

HEK293

C-hFc

P47873 (P22-L199)

16156  [NCBI]

PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL

50-60 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 10 mMHAc-NaAc, 150 mM NaCl, 0.004% Tween80, 5% Mannitol, pH 4.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.