1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-12
  5. IL-12 Protein, Cynomolgus (HEK293, His)

IL-12 Protein, forming a heterodimer with IL23A, generates the cytokine IL-23, pivotal in innate and adaptive immunity. Collaborating with IL-17, IL-23 prompts an acute response to infection in peripheral tissues. Binding to the receptor complex IL12RB1 and IL23R, IL-23 activates Jak-Stat signaling, preferentially stimulates memory T-cells, and induces pro-inflammatory cytokine production. Implicated in autoimmune inflammation and tumorigenesis, IL-23 acts as a growth factor for activated T and NK cells, enhances NK cell lytic activity, and stimulates IFN-gamma production by resting PBMC. IL-12 Protein, Cynomolgus (HEK293, His) is a recombinant protein dimer complex containing cynomolgus-derived IL-12 protein, expressed by HEK293, with C-His labeled tag. IL-12 Protein, Cynomolgus (HEK293, His), has molecular weight of 45-48 kDa (IL-12B) & 38-44 kDa (IL-12A), respectively.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-12 Protein, forming a heterodimer with IL23A, generates the cytokine IL-23, pivotal in innate and adaptive immunity. Collaborating with IL-17, IL-23 prompts an acute response to infection in peripheral tissues. Binding to the receptor complex IL12RB1 and IL23R, IL-23 activates Jak-Stat signaling, preferentially stimulates memory T-cells, and induces pro-inflammatory cytokine production. Implicated in autoimmune inflammation and tumorigenesis, IL-23 acts as a growth factor for activated T and NK cells, enhances NK cell lytic activity, and stimulates IFN-gamma production by resting PBMC. IL-12 Protein, Cynomolgus (HEK293, His) is a recombinant protein dimer complex containing cynomolgus-derived IL-12 protein, expressed by HEK293, with C-His labeled tag. IL-12 Protein, Cynomolgus (HEK293, His), has molecular weight of 45-48 kDa (IL-12B) & 38-44 kDa (IL-12A), respectively.

Background

The IL-12 Protein forms a heterodimer with IL23A, resulting in the creation of the IL-23 interleukin, a cytokine with diverse functions in innate and adaptive immunity. In collaboration with IL-17, IL-23 may orchestrate an acute response to infection in peripheral tissues. Binding to a heterodimeric receptor complex composed of IL12RB1 and IL23R, IL-23 activates the Jak-Stat signaling cascade, preferentially stimulates memory T-cells over naive T-cells, and facilitates the production of pro-inflammatory cytokines. Furthermore, IL-23 has been implicated in inducing autoimmune inflammation, potentially playing a role in autoimmune inflammatory diseases and tumorigenesis. This cytokine acts as a growth factor for activated T and NK cells, enhances the lytic activity of NK/lymphokine-activated killer cells, and stimulates the production of IFN-gamma by resting PBMC.

Biological Activity

1.Immobilized Cynomolgus IL-12, His Tag at 0.5 μg/mL(100 μl/well) on the plate. Dose response curve for Anti-IL-12 Antibody, hFc Tag with the EC50 of <8.5 ng/mL determined by ELISA.
2.Measured by its ability to enhance IFN-gamma secretion in NK-92 human natural killer lymphoma cells. The ED50 for this effect is 0.7733 ng/mL, corresponding to a specific activity is 1.293×106 U/mg.

Species

Cynomolgus

Source

HEK293

Tag

C-His

Accession

G7P6S2 (I23-S328)&XP_005546300.2 (R57-S253)

Gene ID

/&102115316

Synonyms
CLMF; CLMF2; IL-12A; IL-12B; IL12; IL12 p70; IMD28; IMD29; NFSK; NKSF1; NKSF2; P35; IL-12 subunit p35; IL12A; interleukin 12
AA Sequence

A1:IWELKKDVYV
VELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSGEVLGSGKTLTIQVKEFGDAGQYTCHKGGEALSHSLLLLHKKEDGIWSTDVLKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSNPQGVTCGAVTLSAERVRGDNKEYEYSVECQEDSACPAAEERLPIEVMVDAIHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCIQVQGKSKREKKDRIFTDKTSATVICRKNASFSVQAQDRYYSSSWSEWASVPCS
A2:RNLSVATPGP
EMFPCLHHSQNLLKAASNTLQKARQILEFYPCTSEEIDHEDITKDKTSTVEACLPLELIKNESCLNSRETSFITNGSCLASRKTSFMMALCLRSIYEDLKMYQVEFKTMNAKLLRDPKRQIFLDQNILGVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS

Molecular Weight

45-48 kDa (IL-12B) & 38-44 kDa (IL-12A)

Purity

Greater than 95% as determined by Tris-Bis PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-12 Protein, Cynomolgus (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-12 Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P701008
Quantity:
MCE Japan Authorized Agent: