IL-12 Protein, Rat (CHO)

IL-12 Protein, Rat (CHO) is an inflammatory cytokine that promotes the response of the immune system.

Interleukin-12 is a heterodimeric inflammatory cytokine. Interleukin-12 is a potent cytokine that plays an important role in regulating the response of the adaptive immune system by driving the differentiation of naive T-cells to Th1 cells, which is important for protection against intracellular pathogens^[1].

The ED₅₀ is <0.1 ng/mL as measured by 2D6 cells.

Rat

CHO

Tag Free

Q9R103 (R23-S215)&E9PU71 (M23-S335)

84405  [NCBI]&64546  [NCBI]

p35:
RVIPVSGPAKCLNQSQNLLKTTDDMVRTAREKLKHYSCTAGDIDHEDITRDKTSTLEACLPLELHKNESCLATKETSSIIRGSCLPPQKTSLMMTLCLGSIYEDLKMYQSEFQAINAALQSHNHQQITLDRNMLMAIDELMRSLNHSGETLHQKAPMGEADPYRVKMKLCILLHAFSTRVMTINRVMNYLSSSHHHHHH
p40:
MWELEKDVYVVEVDWRPDAPGETVTLTCDSPEEDDITWTSDQRRGVIGSGKTLTITVREFLDAGQYTCHRGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVHRNTDLKFNIKSSSSSPESRAVTCGRASLSAEKVTLNQRDYEKYSVACQEDVTCPTAEETLPIELVVEAQQQNKYENYSTSFFIRDIIKPDPPKNLQVKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKTKETEEECNQKGAFLVEKTSAEVQCKGANICVQAQDRYYNSSCSKWTCVPCRGRS

26-28 kDa (p35) and 42-45 kDa (p40)

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against PBS.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Issaranggun Na Ayuthaya B, et al. The immunopathogenic and immunomodulatory effects of interleukin-12 in periodontal disease. Eur J Oral Sci. 2018 Apr;126(2):75-83.  [Content Brief]