IL-12 Protein, Rat (HEK293, His)

IL-12 Protein forms the IL-12 cytokine and IL-35 cytokine. It regulates T-cell and natural killer-cell responses, stimulates interferon-gamma production, and promotes T-helper 1 cell differentiation. Its receptor, composed of IL12R1 and IL12R2 subunits, activates STAT4 and regulates gene expression. In the context of IL-35, IL-12 Protein maintains immune homeostasis and acts as an immune-suppressive cytokine. It signals through unconventional receptors and requires STAT1 and STAT4 transcription factors. It also interacts with NBR1 to promote IL-12 secretion. IL-12 Protein, Rat (HEK293, His) is a recombinant protein dimer complex containing rat-derived IL-12 protein, expressed by HEK293, with C-6*His labeled tag. IL-12 Protein, Rat (HEK293, His), has molecular weight of 25-35 & 40-50 kDa, respectively.

The IL-12 Protein has the ability to heterodimerize with IL12B to form the IL-12 cytokine, or with EBI3/IL27B to form the IL-35 cytokine. It is primarily produced by professional antigen-presenting cells such as B-cells, dendritic cells, macrophages, and granulocytes, and plays a crucial role in regulating T-cell and natural killer-cell responses. IL-12 stimulates the production of interferon-gamma and promotes the differentiation of T-helper 1 cells, bridging the gap between innate resistance and adaptive immunity. Its biological effects are mediated through a receptor composed of IL12R1 and IL12R2 subunits, leading to the phosphorylation of cellular substrates including TYK2 and JAK2. This, in turn, activates STAT4 and facilitates the regulation of cytokine/growth factor responsive genes. In the context of IL-35, IL-12 Protein contributes to maintaining immune homeostasis in the liver microenvironment and acts as an immune-suppressive cytokine. Its signaling occurs through unconventional receptors composed of IL12RB2 and gp130/IL6ST heterodimers or homodimers, and requires the involvement of transcription factors STAT1 and STAT4. Furthermore, IL-12 Protein can form a disulfide-linked heterodimer with IL12B, known as interleukin IL-12, and a non-disulfide-linked heterodimer with EBI3/IL27B, known as interleukin IL-35. Additionally, it interacts with NBR1, promoting the secretion of IL-12.

Rat

HEK293

C-6*His

Q9R103 (R23-S215)&Q9R278 (M23-S335)

84405  [NCBI]&64546  [NCBI]

MWELEKDVYVVEVDWRPDAPGETVTLTCDSPEEDDITWTSDQRRGVIGSGKTLTITVREFLDAGQYTCHRGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVHRNTDLKFNIKSSSSSPESRAVTCGRASLSAEKVTLNQRDYEKYSVACQEDVTCPTAEETLPIELVVEAQQQNKYENYSTSFFIRDIIKPDPPKNLQVKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKTKETEEECNQKGAFLVEKTSAEVQCKGANICVQAQDRYYNSSCSKWTCVPCRGRS&RVIPVSGPAKCLNQSQNLLKTTDDMVRTAREKLKHYSCTAGDIDHEDITRDKTSTLEACLPLELHKNESCLATKETSSIIRGSCLPPQKTSLMMTLCLGSIYEDLKMYQSEFQAINAALQSHNHQQITLDRNMLMAIDELMRSLNHSGETLHQKAPMGEADPYRVKMKLCILLHAFSTRVMTINRVMNYLSSS

25-35&40-50 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.