1. Recombinant Proteins
  2. Others
  3. IL-1RA/IL-1F3 Protein, Porcine

IL-1RA/IL-1F3 proteins are powerful anti-inflammatory antagonists in the interleukin 1 family, specifically targeting the pro-inflammatory cytokines IL1B and IL1A. This protein counteracts the inflammatory effects of IL1, playing a critical role in preventing immune dysregulation and preventing uncontrolled systemic inflammation triggered by a variety of innate irritants, including pathogens. IL-1RA/IL-1F3 Protein, Porcine is the recombinant Porcine-derived IL-1RA/IL-1F3 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg USD 95 In-stock
10 μg USD 160 In-stock
50 μg USD 450 In-stock
100 μg USD 765 In-stock
500 μg USD 2150 In-stock
> 500 μg   Get quote  

Get it by June 3 for select sizes. Order within 20 hrs 38 mins.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-1RA/IL-1F3 proteins are powerful anti-inflammatory antagonists in the interleukin 1 family, specifically targeting the pro-inflammatory cytokines IL1B and IL1A. This protein counteracts the inflammatory effects of IL1, playing a critical role in preventing immune dysregulation and preventing uncontrolled systemic inflammation triggered by a variety of innate irritants, including pathogens. IL-1RA/IL-1F3 Protein, Porcine is the recombinant Porcine-derived IL-1RA/IL-1F3 protein, expressed by E. coli , with tag free.

Background

The IL-1RA/IL-1F3 protein serves as a potent anti-inflammatory antagonist within the interleukin-1 family, specifically targeting proinflammatory cytokines like interleukin-1beta/IL1B and interleukin-1alpha/IL1A. With its ability to counteract the inflammatory effects of IL1, this protein plays a crucial role in protecting against immune dysregulation and preventing uncontrolled systemic inflammation induced by a variety of innate stimulatory agents, including pathogens. By acting as a regulatory shield against IL1-mediated responses, IL-1RA/IL-1F3 contributes significantly to maintaining immune balance and curtailing excessive inflammatory reactions.

Biological Activity

Measured by its ability to inhibit IL-1 alpha -dependent proliferation in CTLL-2. The ED50 for this effect is 0.03295 μg/mL in the presence of 50 pg/mL of recombinant porcine IL-1 alpha, corresponding to a specific activity is 4.18×10^4 units/mg.

  • Measured by its ability to inhibit IL-1 alpha -dependent proliferation in CTLL-2. The ED50 for this effect is 0.03295 μg/mL in the presence of 50 pg/mL of recombinant porcine IL-1 alpha, corresponding to a specific activity is 4.18×104 units/mg.
Species

Porcine

Source

E. coli

Tag

Tag Free

Accession

Q29056 (H26-Q177)

Gene ID
Molecular Construction
N-term
IL-1RA (H26-Q177)
Accession # Q29056
C-term
Synonyms
Interleukin-1 receptor antagonist protein; IL1RN; IL-1RN; IL-1ra; IRAP; IL1 inhibitor; IRAP1; Interleukin 1 Receptor Antagonist
AA Sequence

HPLGKRPCRMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNTKLEEKIDVVPVEPHFVFLGIHGGKLCLSCVKSGDEMKLQLDAVNITDLRKNSEQDKRFTFIRSDSGPTTSFESAACPGWFLCTALEADQPVGLTNTPKAAVKVTKFYFQQDQ

Molecular Weight

Approximately 17.55 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-1RA/IL-1F3 Protein, Porcine Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-1RA/IL-1F3 Protein, Porcine
Cat. No.:
HY-P79293
Quantity:
MCE Japan Authorized Agent: