1. Recombinant Proteins
  2. Others
  3. IL-1RA/IL-1F3 Protein, Porcine

The IL-1RA/IL-1F3 protein, a robust anti-inflammatory antagonist in the interleukin-1 family, specifically targets proinflammatory cytokines IL1B and IL1A. Countering IL1's inflammatory effects, this protein crucially protects against immune dysregulation and prevents uncontrolled systemic inflammation triggered by various innate stimulatory agents, including pathogens. Serving as a regulatory shield against IL1-mediated responses, IL-1RA/IL-1F3 significantly contributes to maintaining immune balance and curtailing excessive inflammatory reactions. IL-1RA/IL-1F3 Protein, Porcine is the recombinant Porcine-derived IL-1RA/IL-1F3 protein, expressed by E. coli, with tag free. The total length of IL-1RA/IL-1F3 Protein, Porcine is 152 a.a., with molecular weight of ~17.55 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The IL-1RA/IL-1F3 protein, a robust anti-inflammatory antagonist in the interleukin-1 family, specifically targets proinflammatory cytokines IL1B and IL1A. Countering IL1's inflammatory effects, this protein crucially protects against immune dysregulation and prevents uncontrolled systemic inflammation triggered by various innate stimulatory agents, including pathogens. Serving as a regulatory shield against IL1-mediated responses, IL-1RA/IL-1F3 significantly contributes to maintaining immune balance and curtailing excessive inflammatory reactions. IL-1RA/IL-1F3 Protein, Porcine is the recombinant Porcine-derived IL-1RA/IL-1F3 protein, expressed by E. coli, with tag free. The total length of IL-1RA/IL-1F3 Protein, Porcine is 152 a.a., with molecular weight of ~17.55 kDa.

Background

The IL-1RA/IL-1F3 protein serves as a potent anti-inflammatory antagonist within the interleukin-1 family, specifically targeting proinflammatory cytokines like interleukin-1beta/IL1B and interleukin-1alpha/IL1A. With its ability to counteract the inflammatory effects of IL1, this protein plays a crucial role in protecting against immune dysregulation and preventing uncontrolled systemic inflammation induced by a variety of innate stimulatory agents, including pathogens. By acting as a regulatory shield against IL1-mediated responses, IL-1RA/IL-1F3 contributes significantly to maintaining immune balance and curtailing excessive inflammatory reactions.

Biological Activity

Measured by its ability to inhibit IL-1 alpha -dependent proliferation in CTLL-2. The ED50 for this effect is 0.03295 μg/mL in the presence of 50 pg/mL of recombinant porcine IL-1 alpha, corresponding to a specific activity is 4.18×10^4 units/mg.

  • Measured by its ability to inhibit IL-1 alpha -dependent proliferation in CTLL-2. The ED50 for this effect is 0.03295 μg/mL in the presence of 50 pg/mL of recombinant porcine IL-1 alpha, corresponding to a specific activity is 4.18×104 units/mg.
Species

Porcine

Source

E. coli

Tag

Tag Free

Accession

Q29056 (H26-Q177)

Gene ID
Molecular Construction
N-term
IL-1RA (H26-Q177)
Accession # Q29056
C-term
Synonyms
Interleukin-1 receptor antagonist protein; IL1RN; IL-1RN; IL-1ra; IRAP; IL1 inhibitor; IRAP1; Interleukin 1 Receptor Antagonist
AA Sequence

HPLGKRPCRMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNTKLEEKIDVVPVEPHFVFLGIHGGKLCLSCVKSGDEMKLQLDAVNITDLRKNSEQDKRFTFIRSDSGPTTSFESAACPGWFLCTALEADQPVGLTNTPKAAVKVTKFYFQQDQ

Molecular Weight

Approximately 17.55 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-1RA/IL-1F3 Protein, Porcine Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-1RA/IL-1F3 Protein, Porcine
Cat. No.:
HY-P79293
Quantity:
MCE Japan Authorized Agent: