1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-23
  5. IL-23 Protein, Mouse (HEK293)

IL-23 alpha is a key component that binds to IL12B to produce IL-23 interleukin, a heterodimeric cytokine critical in innate and adaptive immunity. IL-23 functions together with IL-17 in peripheral tissues to respond acutely to infection. IL-23 alpha (175a.a) & IL-12 beta (313a.a) Heterodimer Protein, Mouse (HEK293) is a recombinant protein dimer complex containing mouse-derived IL-23 alpha, expressed by HEK293 , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-23 alpha is a key component that binds to IL12B to produce IL-23 interleukin, a heterodimeric cytokine critical in innate and adaptive immunity. IL-23 functions together with IL-17 in peripheral tissues to respond acutely to infection. IL-23 alpha (175a.a) & IL-12 beta (313a.a) Heterodimer Protein, Mouse (HEK293) is a recombinant protein dimer complex containing mouse-derived IL-23 alpha, expressed by HEK293 , with tag free.

Background

IL-23 alpha, as a crucial component, associates with IL12B to form the IL-23 interleukin, a heterodimeric cytokine playing key roles in both innate and adaptive immunity. Operating in peripheral tissues, IL-23, in conjunction with IL-17, constitutes an acute response to infections. It binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activating the Jak-Stat signaling cascade, preferentially stimulating memory T-cells, and fostering the production of pro-inflammatory cytokines. This cytokine induces autoimmune inflammation, potentially contributing to autoimmune inflammatory diseases and playing a significant role in tumorigenesis. Released by antigen-presenting cells such as dendritic cells or macrophages, IL-23 binds to its receptor complex, initiating signaling pathways that activate various cellular responses, including the production of interleukin-17A/IL17A and promoting early and effective intracellular bacterial clearance. Additionally, IL-23 supports the expansion and survival of T-helper 17 cells, a CD4-positive helper T-cell subset known for producing IL-17, along with other IL-17-producing cells.

Biological Activity

Measured by its ability to induce IL17 secretion by mouse CTLL-2 cells.The ED50 for this effect is ≤ 20.75 ng/mL, corresponding to a specific activity is ≥4.82×104 U/mg.

  • Measured by its ability to induce IL17 secretion by mouse CTLL-2 cells.The ED50 for this effect is 20.75 ng/mL, corresponding to a specific activity is 4.82×104 U/mg.
Species

Mouse

Source

HEK293

Tag

Tag Free

Accession

Q9EQ14 (V22-A196)&P43432 (M23-S335)

Gene ID
Molecular Construction
N-term
IL23A (V22-A196)
Accession # Q9EQ14
C-term
N-term
IL12B (M23-S335)
Accession # P43432
C-term
Synonyms
SGRF; IL-23p19; CLMF p40; IL-12 subunit p40; NKSF2
AA Sequence

VPRSSSPDWAQCQQLSRNLCMLAWNAHAPAGHMNLLREEEDEETKNNVPRIQCEDGCDPQGLKDNSQFCLQRIRQGLAFYKHLLDSDIFKGEPALLPDSPMEQLHTSLLGLSQLLQPEDHPRETQQMPSLSSSQQWQRPLLRSKILRSLQAFLAIAARVFAHGAATLTEPLVPTA&MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS

Predicted Molecular Mass
19.7 (p19)&35.8 (p40) kDa
Molecular Weight

Approximately 40-55 kDa (p40)&18-27kDa (p19), due to glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-23 Protein, Mouse (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-23 Protein, Mouse (HEK293)
Cat. No.:
HY-P70709
Quantity:
MCE Japan Authorized Agent: