IL-25/IL-17E Protein, Human (HEK293, His)

IL-25/IL-17E cytokines are produced by eosinophils, Th2 cells, and epithelial cells and critically regulate the adaptive immune response by modulating cytokine production. It enhances local and systemic type 2 helper T cell responses through its IL17RA and IL17RB receptors and activates the JAK2-STAT5A pathway. IL-25/IL-17E Protein, Human (HEK293, His) is the recombinant human-derived IL-25/IL-17E protein, expressed by HEK293 , with C-6*His labeled tag.

The cytokine Animal-Free IL-25/IL-17E, produced by various cells such as eosinophils, T-helper type 2 (Th2) cells, or epithelial cells, plays a crucial role in the internal safety of adaptive immune responses by regulating cytokine production. This cytokine promotes and augments T-helper type 2 responses both locally and systemically, acting through its receptor composed of IL17RA and IL17RB for signal transduction. Upon binding, Animal-Free IL-25 activates the JAK2-STAT5A pathway, leading to the secretion of type-2-associated cytokines, including IL4, IL9, and IL13. Additionally, it induces the release of IL8 and IL6 from eosinophils by simultaneously activating the MAPK and NF-kappa-B pathways. Notably, Animal-Free IL-25 inhibits the differentiation of T-helper (Th17) cells through the production of IL4, IL5, and IL13, contributing to its regulatory role in immune responses.

Measured by its ability to induce CXCL1 secretion in HT‑29 human colon adenocarcinoma cells. The ED₅₀ for this effect is 1.231 ng/mL, Corresponding to a specific activity is 8.123×10⁵ U/mg.

Human

HEK293

C-6*His

Q9H293-1 (Y33-G177)

64806  [NCBI]

YSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG

20-26 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl,150 mM NaCl 1 mM EDTA, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.